Recombinant Full Length Schizosaccharomyces Pombe Signal Peptidase Complex Subunit Spc2(Spc2) Protein, His-Tagged
Cat.No. : | RFL31798SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Signal peptidase complex subunit spc2(spc2) Protein (Q9UTQ9) (1-167aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-167) |
Form : | Lyophilized powder |
AA Sequence : | MPKYNVSDFKSKFDKELTNHFNKNGYKQSFVFEDIRLLIAIACIIPAGLAFGIEYVYGFG VLKSYLKYLLPLYFLASCLLTFWSSVVKGSTVYVATKKERHIKISADTFLPLKNKPLITT KFTVLKNRNAVQLEWSVPVAHIFEEDGQISSATFEAEISKYLSQIEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | spc2 |
Synonyms | spc2; SPAC1071.04c; Signal peptidase complex subunit spc2; Microsomal signal peptidase subunit 2 |
UniProt ID | Q9UTQ9 |
◆ Recombinant Proteins | ||
ADARB2-329M | Recombinant Mouse ADARB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UGT3A2-3589H | Recombinant Human UGT3A2, GST-tagged | +Inquiry |
PANK1B-5457Z | Recombinant Zebrafish PANK1B | +Inquiry |
CLEC4M-179H | Recombinant Human CLEC4M Protein, His (Fc)-Avi-tagged | +Inquiry |
Il1rap-443M | Recombinant Mouse IL1RAP Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Fxa-282B | Active Native Bovine Factor Xa - EGR | +Inquiry |
FTL-673H | Native Human Ferritin, Light Polypeptide | +Inquiry |
IGHD -20H | Native Human IgD | +Inquiry |
FGB-6H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
CAPN2-121B | Native Bovine CAPN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDIA3-3331HCL | Recombinant Human PDIA3 293 Cell Lysate | +Inquiry |
LINC00303-8176HCL | Recombinant Human C1orf157 293 Cell Lysate | +Inquiry |
NKG7-3819HCL | Recombinant Human NKG7 293 Cell Lysate | +Inquiry |
CCT6B-7687HCL | Recombinant Human CCT6B 293 Cell Lysate | +Inquiry |
KCNK2-97HCL | Recombinant Human KCNK2 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All spc2 Products
Required fields are marked with *
My Review for All spc2 Products
Required fields are marked with *
0
Inquiry Basket