Recombinant Full Length Schizosaccharomyces Pombe Serine Palmitoyltransferase 1(Lcb1) Protein, His-Tagged
Cat.No. : | RFL21167SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Serine palmitoyltransferase 1(lcb1) Protein (O59682) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MSYSYPFFDDVYAYYNQTVTFFGKALDVLPGSPIVKRYIKSSYQNDPLRTFIEFLLLVFA AYYVLRKPRTSPDNNYVEFTEKEINELVDDWKPEPLVAELTDVEKLELKSIPVLESVHLH TKLIDGRPITNFASFNFLDLAENKHITECAVATLRECGLGACGPPGFYGTQDKHLRLEKD IASFIGVERAIVYAQSFQTISSVIPAFSKRGDILVVDEACNFAIQKGIQISRTTIRYFKH NNMKDLERILQELEDDFVKHNRPLTRRFIITEGISENYGDMVDLTKIVALKKKYKYRLIL DETWSFGTCGRTGKGLTEHFGVPPTDVEIIIGSLTTSLAGGGGFCAGSELMVEHQRLSGM AYIYSAALPASLAVAAYEAISILSRDGGSMLNDLRSKSALFHAKLSRNKFFETSSDIESP IIHLRFKDKDISHDKQVFLLEEIVELCIAEGFLIARAKRVESLERVKVQPSLRICISTGH SAEEIEKLALLIKEKTEIVFDKHKVINQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lcb1 |
Synonyms | lcb1; SPBC18E5.02c; SPBC29A3.20c; Serine palmitoyltransferase 1; SPT 1; SPT1; Long chain base biosynthesis protein 1 |
UniProt ID | O59682 |
◆ Recombinant Proteins | ||
ARF3-26994TH | Recombinant Human ARF3, His-tagged | +Inquiry |
NFKBIZ-1401C | Recombinant Chicken NFKBIZ | +Inquiry |
NUS1-1705M | Recombinant Mouse NUS1 Protein (24-120 aa), His-tagged | +Inquiry |
RARA-6141H | Recombinant Human RARA Protein (Ser68-Glu173), His tagged | +Inquiry |
ETV7-4373HF | Recombinant Full Length Human ETV7 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GPOSP-40 | Active Native Glycerol-3-phosphate oxidase | +Inquiry |
C1q-04M | Native Mouse C1q Protein | +Inquiry |
Plg-1897R | Native Rat Plasminogen | +Inquiry |
MMP1-45H | Native Human MMP-1 | +Inquiry |
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF215-1002HCL | Recombinant Human RNF215 cell lysate | +Inquiry |
CD14-1169CCL | Recombinant Cynomolgus CD14 cell lysate | +Inquiry |
TRIM28-1825HCL | Recombinant Human TRIM28 cell lysate | +Inquiry |
Fetus-182R | Rat Fetus (11 Day Fetus) Lysate | +Inquiry |
TBC1D1-1232HCL | Recombinant Human TBC1D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lcb1 Products
Required fields are marked with *
My Review for All lcb1 Products
Required fields are marked with *
0
Inquiry Basket