Recombinant Full Length Schizosaccharomyces Pombe Protein Erd1 Homolog 1(Spac227.01C, Spapb21F2.04C) Protein, His-Tagged
Cat.No. : | RFL20466SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Protein ERD1 homolog 1(SPAC227.01c, SPAPB21F2.04c) Protein (Q9UTD8) (1-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-373) |
Form : | Lyophilized powder |
AA Sequence : | MALIEDLNHFINYFPLVLRLFFLVVFGLYSFTLILHLLVINRVDVFSLLHTPLPVNRSQQ ANAPLWQLSFSLSILGTLLFVIAESLYLISGSDELAYVPVFIFGVIVFMPVHKFWFFQRK VFTRQCLRILGGSYRPDYKFPDVIFSDLLTSYSRVIADLWLAGAILIYVTDSPNNSHRKQ YENEVIMSMIAAYPYAIRFRQCLIERSSADNSSDKFWSTLNSIKYFTAFPAIFLGIFAKK RFSFLWFLWNTSSAINSTYSFWWDVSMDWSLPFFKQPLSIQNWKFGVRRLFPTFTFAVVS AIDFVLRMAWVVRVLPEHQSAFFTTDFGIFIMQFLEVFRRCVWVFFRIEAEASKSLAYVN ISDRSDIPTIHPD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | erd1 |
Synonyms | erd1; SPAC227.01c; SPAPB21F2.04c; Protein ERD1 homolog 1 |
UniProt ID | Q9UTD8 |
◆ Recombinant Proteins | ||
ARHGAP45-1740H | Recombinant Human ARHGAP45 protein, His & T7-tagged | +Inquiry |
HNRNPUL1-13877H | Recombinant Human HNRNPUL1, GST-tagged | +Inquiry |
Cd4-1560M | Recombinant Mouse Cd4 protein, His-tagged | +Inquiry |
SUH-0015P2-2483S | Recombinant Staphylococcus aureus (strain: 18808) SUH_0015P2 protein, His-tagged | +Inquiry |
Ckm-896M | Recombinant Mouse Ckm Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Colon-009H | Human Colon Lysate, Total Protein | +Inquiry |
gGT-184B | Active Native Bovine Gamma-Glutamyl Transferase | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
AC-62H | Native Human Activated Protein C | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H2BE-5541HCL | Recombinant Human HIST1H2BE 293 Cell Lysate | +Inquiry |
CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
BPIFA2-1338HCL | Recombinant Human BPIFA2 cell lysate | +Inquiry |
GNAQ-5867HCL | Recombinant Human GNAQ 293 Cell Lysate | +Inquiry |
ARL6-8708HCL | Recombinant Human ARL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All erd1 Products
Required fields are marked with *
My Review for All erd1 Products
Required fields are marked with *
0
Inquiry Basket