Recombinant Full Length Schizosaccharomyces Pombe Phosphatidylglycerol Phospholipase C (Spac4D7.02C) Protein, His-Tagged
Cat.No. : | RFL17580SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Phosphatidylglycerol phospholipase C (SPAC4D7.02c) Protein (O14169) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MAFNYSIANTVDDAAQSIAENTSSLATFSKPPLVIAHRGYKAKYPENTILAFQQAVKAGA DCVETDVRLTKDEVVCILHDRNLNRVFGVDVDVRDLDYELDNGHFRTIQEPHEPLPTYEQ FLHELTKHPGVNLLVDIKPVNDLLIIPRMVDAMLRVNSDLDFWKDKVSFCLWSHRFIPAC DRYAPSIPLYHIGFNFAYAERHFVMHPRVKGVSMAVALFLLPHSQDFVDLVHAQGKQVFA WTLNTPSSIYLALIRGCDGLLSDDPVMARALSQGPIVTKSWHYFHYSEWLHMIYGFLRAQ FVFFLLRTFVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC4D7.02c |
Synonyms | SPAC4D7.02c; Phosphatidylglycerol phospholipase C |
UniProt ID | O14169 |
◆ Recombinant Proteins | ||
RAD51C-28601TH | Recombinant Human RAD51C | +Inquiry |
MRPS14-5713M | Recombinant Mouse MRPS14 Protein, His (Fc)-Avi-tagged | +Inquiry |
KMT2D-55H | Recombinant Human KMT2D, GST-tagged | +Inquiry |
CBLB-558HF | Recombinant Full Length Human CBLB Protein, GST-tagged | +Inquiry |
CD1E-724R | Recombinant Rhesus monkey CD1E Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C5a-12H | Active Native Human C5a Anaphylatoxin Protein | +Inquiry |
MB-237C | Native Dog Myoglobin | +Inquiry |
HP-146R | Native Rabbit Hemoglobin | +Inquiry |
RPE-135 | Native Red algae R-Phycoerythrin protein | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIAA1274-916HCL | Recombinant Human KIAA1274 cell lysate | +Inquiry |
KRBOX4-30HCL | Recombinant Human ZNF673 293 Cell Lysate | +Inquiry |
CFHR5-340HCL | Recombinant Human CFHR5 cell lysate | +Inquiry |
SPATA22-1536HCL | Recombinant Human SPATA22 293 Cell Lysate | +Inquiry |
CCDC134-1685HCL | Recombinant Human CCDC134 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC4D7.02c Products
Required fields are marked with *
My Review for All SPAC4D7.02c Products
Required fields are marked with *
0
Inquiry Basket