Recombinant Full Length Schizosaccharomyces Pombe Palmitoyltransferase Akr1(Akr1) Protein, His-Tagged
Cat.No. : | RFL13354SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Palmitoyltransferase akr1(akr1) Protein (Q09701) (1-642aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-642) |
Form : | Lyophilized powder |
AA Sequence : | MGSLFLAASQGELDTVKNLISSEKIDVNATDEGGATALHWAALNQQIPICKFLLEHGADV NAIGGDLQAAPIHWAAKRGSVKTVHYLVQHGADPLLKDKQGFNCLHLAVHAASPLLVVYL LHLDISVDLRDDQQHTPLMWASYHGNEPITNCLLRWGADVLATDEDKMTPLHWSIVGGNL KCMKLILKEGGIPCTAVTANLSGQLKTPWALASELRVSHLFKQALISNGLKVKETSEEPE KWVVVPSKFQFSQKTFIIFCFLSSFIITGVFFFIMSICPMVISLIIAPLWIYFTFKYITT CIHANIDIVHFYLETPFLAGIFSSIFFWVWCHSLLYIVPKTLPIKPLSSLLFVLISFTCI GLYVRTAFQNPGYVDKIGAVVQRREEISKLLDKDLFNQSHYCLKCFQVKPPRSYHCGACK RCINRYDHHCPWTGNCVGARNHRTFLLFVFTLSTLIPIYFYVAFYYLQNIPIQKKYESYR CLFISGTICQWSLKDMFVLVASLTLFVNWCWVVVLAFTQICQVAHNVTTAEFRLFKRYGT LVPPTKQNSSPKNGHGIHGSFLRTVCGILGLDQCILLIRESNCFVRCFPSRAELGSQNST SLSRNLSTVNPYDEGSIIKNCKTFWKQNFLNDGRQDEATRHV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | akr1 |
Synonyms | akr1; SPAC2F7.10; Palmitoyltransferase akr1; Ankyrin repeat-containing protein akr1 |
UniProt ID | Q09701 |
◆ Recombinant Proteins | ||
ST3GAL2-6050C | Recombinant Chicken ST3GAL2 | +Inquiry |
SPRR3-2937H | Recombinant Human SPRR3, GST-tagged | +Inquiry |
MINDY3-455H | Recombinant Human MINDY3 Protein, GST-tagged | +Inquiry |
MLN-5394H | Recombinant Human MLN Protein, GST-tagged | +Inquiry |
POLR2K-8510H | Active Recombinant Human POLR2K, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
Histone-52C | Native Calf Histone | +Inquiry |
Calmodulin-016 | Native Calmodulin Protein | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
LDL-12H | Native Human LDL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRFAP1L1-4207HCL | Recombinant Human MRFAP1L1 293 Cell Lysate | +Inquiry |
ENPP7-2708HCL | Recombinant Human ENPP7 cell lysate | +Inquiry |
TBRG1-654HCL | Recombinant Human TBRG1 lysate | +Inquiry |
NRG1-1599HCL | Recombinant Human NRG1 cell lysate | +Inquiry |
UBE2D2-587HCL | Recombinant Human UBE2D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All akr1 Products
Required fields are marked with *
My Review for All akr1 Products
Required fields are marked with *
0
Inquiry Basket