Recombinant Full Length Schizosaccharomyces Pombe Nuclear Envelope Morphology Protein 1(Nem1) Protein, His-Tagged
Cat.No. : | RFL16390SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Nuclear envelope morphology protein 1(nem1) Protein (O59718) (1-476aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-476) |
Form : | Lyophilized powder |
AA Sequence : | MNSIARLSDEINKAILATPLDDDEADKEKLANARGRASSATLRHYNRRRSSYSASSLSSL SSKPTEKEVPTRNEKPKHANIMRVVVYWIRVFLKRIYTFFVHSARVFLYHFLNEEKEFTL ASFFWGLCRFVFFPVLLSYKRREMLPPQPSVRRPRFYSSYSYPSSHQDPAYSSFKRHRSS NSYSSSSNGNHVRFQPSIAEEEISFNSFSNSLNSEEDVCVSPMKPKEVSLMGKANSNRSG HSHQPQSTQFSPPANDNISKLPSSFTIVNDPLKSPSSSRLRIRNITLCADKIPRPLLNSK LPRKTLVLDLDETLIHSVSRGSRTTSGQPIEVHVPGEHPILYYIHKRPHLDYFLSNVSQW FRLILFTASVQPYADPIIDYLERDKKIFAKRYYRQHCALVDSSFVKDISICNIHLSRIMI IDNSPASYNAHKENAIPIEGWISDPSDVDLLNLLSFLHALQYVHDVRDLLGLRLAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nem1 |
Synonyms | nem1; SPBC3B8.10c; Nuclear envelope morphology protein 1 |
UniProt ID | O59718 |
◆ Recombinant Proteins | ||
NKX6-2-4929H | Recombinant Human NKX6-2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YJBJ-4109B | Recombinant Bacillus subtilis YJBJ protein, His-tagged | +Inquiry |
SSP-RS05695-0644S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS05695 protein, His-tagged | +Inquiry |
PON1-3299H | Recombinant Human PON1 protein, His-GST-tagged | +Inquiry |
EIF3L-4281HF | Recombinant Full Length Human EIF3L Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C6-55H | Native Human Complement C6 | +Inquiry |
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
CP-8074M | Native Mouse Serum Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO28-6301HCL | Recombinant Human FBXO28 293 Cell Lysate | +Inquiry |
FGFR4-1516RCL | Recombinant Rat FGFR4 cell lysate | +Inquiry |
MS4A12-4128HCL | Recombinant Human MS4A12 293 Cell Lysate | +Inquiry |
INMT-347HCL | Recombinant Human INMT lysate | +Inquiry |
CCL11-7735HCL | Recombinant Human CCL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nem1 Products
Required fields are marked with *
My Review for All nem1 Products
Required fields are marked with *
0
Inquiry Basket