Recombinant Full Length Schizosaccharomyces Pombe Nuclear Control Of Atpase Protein 2(Nca2) Protein, His-Tagged
Cat.No. : | RFL6279SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Nuclear control of ATPase protein 2(nca2) Protein (O74963) (1-573aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-573) |
Form : | Lyophilized powder |
AA Sequence : | MELYQKHLKDVYANFNKLAAVHGETTSNSVTFHVFQQLDSTNLTNYQLENVITQVKELDK GPKDYLYWVILGRCSAHLHVKMLDQLLEEAMIMSDNLHYWESIDKNWYSRVLFLIQSFPT RLYHICRNSIKSILQFQNFSNIFAKKNLFPKVSKSDVLLFPRDAFISQASLLSLIRHEYR GNAKRLRQLRDEHACKIGCLTRAIMSEGVSDAASSSGDKNGISAKADLKQVVSQWIQRLS QLQGQKIDNSESLPDILSITLDNLSHPTDEYFEAKAYFRPSAIERNWPKIFVTLLSAWLS TQIITKNRTSIRLWIDYLYSTAVDFYTNWIQKPILGIFDTIRSNRADSQITLLQTKSLES DMESLQRMVIDFVSDTSPAGINLDLVKQEVQQGDLTYVLQAYEHDLKTPIRTAVSGNLVR TLLIQLQKTKVDVEVALSGIDRLLKSQELVFATVGITPSLIFCYVIIRYVKANIFNNDTL SRAERRQRFRQSLRAAERILVRSQKMNSLDDMSYGLLVFQVNLMAIMSMDMGLSKDVAED LLQDLEDIQSSSYGVQAQLRAVDRIYRLFKNSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nca2 |
Synonyms | nca2; SPBC4B4.02c; Nuclear control of ATPase protein 2 |
UniProt ID | O74963 |
◆ Recombinant Proteins | ||
RND2-21H | Recombinant Human RND2 protein, MBP-His-tagged | +Inquiry |
NUP50-1915C | Recombinant Chicken NUP50 | +Inquiry |
MKL1-5572M | Recombinant Mouse MKL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SHISA4-6720H | Recombinant Human SHISA4 Protein (Gly28-Ala197), N-His tagged | +Inquiry |
JAK2-5441H | Recombinant Human Janus Kinase 2, GST-His-tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
LOC780933-24B | Native Bovine Immobilized Anhydrotrypsin | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL14-2223HCL | Recombinant Human RPL14 293 Cell Lysate | +Inquiry |
PARL-3431HCL | Recombinant Human PARL 293 Cell Lysate | +Inquiry |
TIMM17B-1069HCL | Recombinant Human TIMM17B 293 Cell Lysate | +Inquiry |
LRRFIP2-1034HCL | Recombinant Human LRRFIP2 cell lysate | +Inquiry |
CNTN2-3035HCL | Recombinant Human CNTN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nca2 Products
Required fields are marked with *
My Review for All nca2 Products
Required fields are marked with *
0
Inquiry Basket