Recombinant Full Length Schizosaccharomyces Pombe Lysophospholipid Acyltransferase(Ale1) Protein, His-Tagged
Cat.No. : | RFL20066SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Lysophospholipid acyltransferase(ale1) Protein (O42916) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MAYLIDIPFEYFSSFLGVHPDQLKLLFCFLSAYPFAGILKRLPSAPWIRNLFSISIGLFY LIGVHHLYDGVLVLLFDALFTYFVAAFYRSSRMPWIIFIVILGHTFSSHVIRYIYPSENT DITASQMVLCMKLTAFAWSVYDGRLPSSELSSYQKDRALRKIPNILYFLGYVFFFPSLLV GPAFDYVDYERFITLSMFKPLADPYEKQITPHSLEPALGRCWRGLLWLILFITGSSIYPL KFLLTPKFASSPILLKYGYVCITAFVARMKYYGAWELSDGACILSGIGYNGLDSSKHPRW DRVKNIDPIKFEFADNIKCALEAWNMNTNKWLRNYVYLRVAKKGKRPGFKSTLSTFTVSA MWHGVSAGYYLTFVSAAFIQTVAKYTRRHVRPFFLKPDMETPGPFKRVYDVIGMVATNLS LSYLIISFLLLNLKESIHVWKELYFIVHIYILIALAVFNSPIRSKLDNKIRSRVNSYKLK SYEQSMKSTSDTDMLNMSVPKREDFENDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ale1 |
Synonyms | ale1; lpt1; SPBC16A3.10; Lysophospholipid acyltransferase; LPLAT; 1-acyl-sn-glycerol-3-phosphate acyltransferase; AGPAT; Lysophosphatidic acid acyltransferase; LPAAT; Lysophosphatidylcholine acyltransferase; LPCAT; Lysophosphatidylethanolamine acyltransfe |
UniProt ID | O42916 |
◆ Recombinant Proteins | ||
TNFRSF18-1787R | Recombinant Rhesus Monkey TNFRSF18 Protein, hIgG4-tagged | +Inquiry |
RFL8214XF | Recombinant Full Length Xenopus Laevis Marvel Domain-Containing Protein 1(Marveld1) Protein, His-Tagged | +Inquiry |
CD59-15902H | Recombinant Human CD59, His-tagged | +Inquiry |
CCS-711R | Recombinant Rhesus monkey CCS Protein, His-tagged | +Inquiry |
KIN-2229R | Recombinant Rhesus Macaque KIN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GFAP-526H | Native Human GFAP protein | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
B. abortus-23 | Native Brucella abortus Antigen | +Inquiry |
UO-44 | Active Native Urate oxidase | +Inquiry |
FDP-Y-52H | Native Human Fibrinogen Degrading Product-Y | +Inquiry |
◆ Cell & Tissue Lysates | ||
NXT2-3617HCL | Recombinant Human NXT2 293 Cell Lysate | +Inquiry |
ICAM2-2427HCL | Recombinant Human ICAM2 cell lysate | +Inquiry |
CHMP6-7529HCL | Recombinant Human CHMP6 293 Cell Lysate | +Inquiry |
TNFAIP2-695HCL | Recombinant Human TNFAIP2 lysate | +Inquiry |
MEOX1-4366HCL | Recombinant Human MEOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ale1 Products
Required fields are marked with *
My Review for All ale1 Products
Required fields are marked with *
0
Inquiry Basket