Recombinant Full Length Schizosaccharomyces Pombe Low-Affinity Iron/Zinc Ion Transport Protein Fet4(Fet4) Protein, His-Tagged
Cat.No. : | RFL21868SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Low-affinity iron/zinc ion transport protein fet4(fet4) Protein (Q9HFE1) (1-584aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-584) |
Form : | Lyophilized powder |
AA Sequence : | MTASITEIDSISEESNVESVSHLQHSPSFEKKGADFSISLNEKKDFASPITEEIPSPDGI ATPEPETKKKLSFGARVWDLICSPGRQHDVCVAAPTQLVRSCDDYANSASTLVTNDDGTK TKVDSDEKKHKHKNVRDYIRFKHVDIGGRIFDLITRLAGTSFTFILMLIILIVWAIVGGI YRAPDNWQIVMQDGSSIQCYVSDTLLMRQQQNQHIQVLTMISQLRSRLLTTSRLLGPVLN DKTKISSVNVALMKDDVGDAEKLPTENWFDFICNYVSFMVGSIIFLVVYWIGIFIWIGFG RMLGWSDEWQLYINTAVAVELTFTSVFLQNVRHRHMKYIDRCVTSIFRIDSVIEEELRRM MGDKEPNEEITIKMDKINLGERSIDYYADLIGSGVGVVVSTCVFVAWIAIGNVMHWDSNW WLIIGTYTGLVGFLDGFVLRNVYFRESSKEATEIQTLIDEDYALYQKLDLPLPHEHITNY KSTFGGSLSQWIGWLCALPISVLFSVFVILGLIIAAGSLRFNETAQLFCNTPTMIIEGAL LIVLIEAHNIANLKRRIQFRQIHLRRLTILKMLAGDNYSTTSTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fet4 |
Synonyms | fet4; SPBP26C9.03c; Low-affinity iron/zinc ion transport protein fet4 |
UniProt ID | Q9HFE1 |
◆ Native Proteins | ||
IgG-347G | Native Guinea Pig Gamma Globulin Fraction | +Inquiry |
VTN-386R | Native Rabbit Vitronectin | +Inquiry |
CA242-161H | Active Native Human Cancer Antigen 242 | +Inquiry |
IgG-01H | Native Human Immunoglobulin G | +Inquiry |
F9-301R | Native Rat Factor IXa | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPF4B-2824HCL | Recombinant Human PRPF4B 293 Cell Lysate | +Inquiry |
COMMD2-7371HCL | Recombinant Human COMMD2 293 Cell Lysate | +Inquiry |
P2RX5-3497HCL | Recombinant Human P2RX5 293 Cell Lysate | +Inquiry |
ASPH-8645HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry |
Striatum-558M | MiniPig Striatum Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fet4 Products
Required fields are marked with *
My Review for All fet4 Products
Required fields are marked with *
0
Inquiry Basket