Recombinant Full Length Schizophyllum Commune Probable Endonuclease Lcl3(Lcl3) Protein, His-Tagged
Cat.No. : | RFL33989SF |
Product Overview : | Recombinant Full Length Schizophyllum commune Probable endonuclease LCL3(LCL3) Protein (D8QGA7) (1-292aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizophyllum commune |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-292) |
Form : | Lyophilized powder |
AA Sequence : | MPLIPWPASADDSSKGKDDEKDIATKAKELFALAGEIPPEYFSVAAFAAGSLSLAASYFV HKRYFRRIPNAEWVSPNHLARKRWIKGRVTSVGDNDNFRFYHTPGIGWRWPLKFRRVPTL TKELKDQTIHVRIAGVDAPENAHFGRPAQPYAQEALAYLRARILGKTVFCQLIRRDQYGR MVSHVRLAPRFLPATLFRGPNLAEDMLRKGWATTYEQHGAEYGEGGVERYKQIEQEAKDA RRGIWAKGVRGETPAEYKRRYAQAADGGEPPSKARAEKEQKRGWLQRLFSWK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LCL3 |
Synonyms | LCL3; SCHCODRAFT_70433; Probable endonuclease LCL3 |
UniProt ID | D8QGA7 |
◆ Native Proteins | ||
FGG -48S | Native Sheep Fibrinogen, FITC Labeled | +Inquiry |
DIP-25 | Active Native NADPH dehydrogenase | +Inquiry |
IgG-332S | Native Swine IgG | +Inquiry |
Collagen-01B | Native Bovine Type II Collagen | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAT2-4815HCL | Recombinant Human LAT2 293 Cell Lysate | +Inquiry |
NFATC1-3859HCL | Recombinant Human NFATC1 293 Cell Lysate | +Inquiry |
SMURF2-1646HCL | Recombinant Human SMURF2 293 Cell Lysate | +Inquiry |
NFIA-3853HCL | Recombinant Human NFIA 293 Cell Lysate | +Inquiry |
ANKS3-26HCL | Recombinant Human ANKS3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCL3 Products
Required fields are marked with *
My Review for All LCL3 Products
Required fields are marked with *
0
Inquiry Basket