Recombinant Full Length Coccidioides Posadasii Probable Endonuclease Lcl3(Lcl3) Protein, His-Tagged
Cat.No. : | RFL26072CF |
Product Overview : | Recombinant Full Length Coccidioides posadasii Probable endonuclease LCL3(LCL3) Protein (C5P0Z4) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coccidioides posadasii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MKWLFWASPPQDDSNSNSGAASQVKCRNNENVDVPAPSNAAPPSDRTISKVQSSSRDWNS IVNATDWKQFTEPRTIIPTALVTGGILLCVHIHRKYLRRIPEAGHISPSFFRRRSLLGKV TSVGDGDNFRMYHTPGGKLGGWEWWRKVPTGKNELKNRTIHVRLAGVDAPELPHFGRPAQ PFSQEAHSWLTNYILGRRVRAHLYRPDQYGRVVATVYVRRWLFFRQDVGLQMLKHGLATV YEAKTGVEFGGVELERQYREAEACAKKKGKGMWKALKGGTKGEWESPREYKTRMAAEEGQ KKNARGITRKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LCL3 |
Synonyms | LCL3; CPC735_070340; Probable endonuclease LCL3 |
UniProt ID | C5P0Z4 |
◆ Recombinant Proteins | ||
YUIH-2737B | Recombinant Bacillus subtilis YUIH protein, His-tagged | +Inquiry |
SH-RS08960-5748S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS08960 protein, His-tagged | +Inquiry |
TNFSF13B-112H | Recombinant Human TNFSF13B Protein, DYKDDDDK-tagged | +Inquiry |
B3GNT5B-5841Z | Recombinant Zebrafish B3GNT5B | +Inquiry |
SNRPG-2716H | Recombinant Human SNRPG Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Sphingomyelinase-38S | Active Native Staphylococcus aureus Sphingomyelinase | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
Lectin-1785G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Fluorescein labeled | +Inquiry |
PAEP-04B | Native Bovine PAEP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIK3CB-3188HCL | Recombinant Human PIK3CB 293 Cell Lysate | +Inquiry |
HDAC6-5603HCL | Recombinant Human HDAC6 293 Cell Lysate | +Inquiry |
Fetal Temporal Lobe -170H | Human Fetal Temporal Lobe Membrane Lysate | +Inquiry |
Broccoli-686P | Broccoli Lysate, Total Protein | +Inquiry |
MLF1-4297HCL | Recombinant Human MLF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCL3 Products
Required fields are marked with *
My Review for All LCL3 Products
Required fields are marked with *
0
Inquiry Basket