Recombinant Full Length Scheffersomyces Stipitis Mitochondrial Thiamine Pyrophosphate Carrier 1(Tpc1) Protein, His-Tagged
Cat.No. : | RFL29275SF |
Product Overview : | Recombinant Full Length Scheffersomyces stipitis Mitochondrial thiamine pyrophosphate carrier 1(TPC1) Protein (A3LVX1) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Scheffersomyces stipitis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-305) |
Form : | Lyophilized powder |
AA Sequence : | MESRKREDHLRKGSEVSPYESLLAGSISGAVARAVTAPLDTIKIRLQLQRSAFRSRVSVT TVVKDLLKNEGAIALWKGNVPAEILYVLYGAAQFTTYSSISRWLSHLSDTSGFNLPSSAH SLVSGTGAGVVSTLVTYPFDLLRTRLAANSEKKLLSMSGTAREIISSEGFTGLFAGIKPA MLSISTTTGLMFWSYELVRETLGDRDIPFKEGICGFIAGATSKGITFPLDTIRKRTQMYK ILYNSAKRVGAFRLLADIVANEGVLGLYKGFGISVLKTSPTSAVSLFVYEYSLAAIQRIN RKTLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TPC1 |
Synonyms | TPC1; PICST_60941; Mitochondrial thiamine pyrophosphate carrier 1 |
UniProt ID | A3LVX1 |
◆ Native Proteins | ||
FGA-6H | Native Human Fibrinogen Protein, Alexa Fluor 488 labeled | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
LDLc-01H | Native Human Low-Density Lipoprotein cholesterol | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPR-001HCL | Recombinant Human HNRNPR cell lysate | +Inquiry |
PBK-713HCL | Recombinant Human PBK cell lysate | +Inquiry |
CBFB-7815HCL | Recombinant Human CBFB 293 Cell Lysate | +Inquiry |
Onion-701P | Onion Lysate, Total Protein | +Inquiry |
SLC39A7-1717HCL | Recombinant Human SLC39A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPC1 Products
Required fields are marked with *
My Review for All TPC1 Products
Required fields are marked with *
0
Inquiry Basket