Recombinant Full Length Botryotinia Fuckeliana Mitochondrial Thiamine Pyrophosphate Carrier 1(Tpc1) Protein, His-Tagged
Cat.No. : | RFL23779BF |
Product Overview : | Recombinant Full Length Botryotinia fuckeliana Mitochondrial thiamine pyrophosphate carrier 1(tpc1) Protein (A6SL61) (1-322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Botryotinia fuckeliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-322) |
Form : | Lyophilized powder |
AA Sequence : | MSESAEHLKDEGSKTQSMIAGATAGLIARFVIAPLDVVKIRLQLQSHSASDPLSQRDLRG SPIYKGTIPTIKRIFREEGLAALWKGNVPAELMYVSYSAIQFTTYRSVTLGLQDAFGEHR LPAAAESFIAGASAGAVATTATYPLDLLRTRFAAQGIERVYTSLRSSIRDIAISEGPRGF FQGLGAGVGQIVPYMGIFFATYESLRLPMGTLNMPFGSADASAGVIASVIAKTGIFPFDL IRKRLQVQGPTRERYVHKNIPVYNGVFQTMRHILHNEGYRGLYRGLTVSLFKSAPASAVT MWTYERVLGILLKWEKSQELSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tpc1 |
Synonyms | tpc1; BC1G_13653; Mitochondrial thiamine pyrophosphate carrier 1 |
UniProt ID | A6SL61 |
◆ Recombinant Proteins | ||
DEPDC1B-207C | Recombinant Cynomolgus Monkey DEPDC1B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35184SF | Recombinant Full Length Protein Mxig(Mxig) Protein, His-Tagged | +Inquiry |
VEGFA-453C | Recombinant Canine VEGFA protein | +Inquiry |
JAM2B-6840Z | Recombinant Zebrafish JAM2B | +Inquiry |
RNPEP-2003HFL | Recombinant Full Length Human RNPEP Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
PLD-18A | Active Native Arachis hypogaea (peanut) Phospholipase D, Type II | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
Proteoglycans-51C | Native Chicken Proteoglycans | +Inquiry |
AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2R5C-2917HCL | Recombinant Human PPP2R5C 293 Cell Lysate | +Inquiry |
PSG9-2783HCL | Recombinant Human PSG9 293 Cell Lysate | +Inquiry |
PLCXD3-1371HCL | Recombinant Human PLCXD3 cell lysate | +Inquiry |
HCT116-018WCY | Human Colon Colorectal Carcinoma HCT116 Whole Cell Lysate | +Inquiry |
ZNF791-2090HCL | Recombinant Human ZNF791 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All tpc1 Products
Required fields are marked with *
My Review for All tpc1 Products
Required fields are marked with *
0
Inquiry Basket