Recombinant Full Length Satsuma Dwarf Virus Rna1 Polyprotein Protein, His-Tagged
Cat.No. : | RFL15760SF |
Product Overview : | Recombinant Full Length Satsuma dwarf virus RNA1 polyprotein Protein (Q9WAL8) (1401-2081aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Satsuma dwarf virus (isolate Satsuma mandarin/Japan/S-58/1977) (SDV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1401-2081) |
Form : | Lyophilized powder |
AA Sequence : | AELDAAILDRFSIPISECRKELTPMTTRLGYVVGQYPRALRKTSIVPSIIHDNLWRKPET EPTILGKIDDRSPFPYDPYATIGEKFVQEVGPIDLSVGSDASLVVANIGSSWKAVGKPQC PTVLTWEVAINGDAAIPYCERLPLSTSEGYPDSIQRNFGEKGKKRFFDLKGENVRVPTPA LMEELEVLERELQKEEVCLTCINTACAKDEKTAPKKVRVQPKTRIFEILPFQINIIIRRY LMFWMQLLMVAHDELPSKVGINVYSESWDRLLGRHTRLANHFTGDYSGFDTSTPRVLVYA IIDKINELADDGEVNQRTRRNIIRFVLNRYLISDGVLYEIHGGTPSGFAPTVMINSVVNE FYLKWSWIGLLKEAGYANQATLYAFHEATEISLYGDDNFVSVATPVASVYNLTTISNFLG RIGVKLGDGAKTGTIKPFIPLEEVDFLKRQFVADSGSTAILCPLKKISIEERLFYVRGGQ DEIAALELNIATALCEAFFHGKEYFSFLEGKIIEAMRKSGVALSRPLPTMESVRAWYMSQ RGNTKIRSPSFEGLGTMSGILNIGLAEARSVGGVACFSGIEFRGRSDDHLMVIPTYIPGG WRTKQQQTYISFVRDSEKMAQVIKRVAHFSTVVATDKSMAYLVAICIAYSRGSISRMEVR CHVQNLKVAEMLLCNQICNFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Satsuma dwarf virus RNA1 polyprotein |
Synonyms | RNA1 polyprotein; P1 |
UniProt ID | Q9WAL8 |
◆ Recombinant Proteins | ||
MET-4389H | Recombinant Human MET protein, hFc-tagged | +Inquiry |
Rapsn-7312M | Recombinant Full Length Mouse Rapsn Protein, His-tagged | +Inquiry |
RSAD2-5186R | Recombinant Rat RSAD2 Protein | +Inquiry |
RABGAP1L-134H | Recombinant Human RABGAP1L Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GABARAP-579H | Recombinant Human GABARAP Protein, His-tagged Protein, Biotinylated | +Inquiry |
◆ Native Proteins | ||
LDH2-8340H | Native Human LDH2 | +Inquiry |
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
BSA-01 | Native Bovine Serum Albumin | +Inquiry |
IgG-007G | Native Goat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
FSHB-81H | Active Native Human FSH | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCPS-7046HCL | Recombinant Human DCPS 293 Cell Lysate | +Inquiry |
Adrenal-130R | Rat Adrenal Tissue Lysate | +Inquiry |
PGM2-3251HCL | Recombinant Human PGM2 293 Cell Lysate | +Inquiry |
RHOC-2352HCL | Recombinant Human RHOC 293 Cell Lysate | +Inquiry |
Kidney-753B | Bovine Kidney Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Satsuma dwarf virus RNA1 polyprotein Products
Required fields are marked with *
My Review for All Satsuma dwarf virus RNA1 polyprotein Products
Required fields are marked with *
0
Inquiry Basket