Recombinant Full Length Salmonella Typhimurium Zinc Transporter Zitb(Zitb) Protein, His-Tagged
Cat.No. : | RFL18607SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Zinc transporter zitB(zitB) Protein (Q8ZQT3) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MAHSHSHADSHLPKDNNARRLLFAFIVTAGFMLLEVVGGILSGSLALLADAGHMLTDAAA LLFALLAVQFSRRPPTVRHTFGWLRLTTLAAFVNAIALVVITLLIVWEAIERFYTPRPVA GNLMMVIAVAGLLANLFAFWILHRGSDEKNLNVRAAALHVMGDLLGSVGAIVAALIIIWT GWTPADPILSILVSVLVLRSAWRLLKDSVNELLEGAPVSLDINALQRHLSREIPEVRNVH HVHVWMVGEKPVMTLHAQVIPPHDHDALLERIQDFLMHEYHIAHATIQMEYQVCHGPDCH LNQTSSGHVHHH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zitB |
Synonyms | zitB; STM0758; Zinc transporter ZitB |
UniProt ID | Q8ZQT3 |
◆ Native Proteins | ||
TG-31519TH | Native Human TG | +Inquiry |
LTF-8194H | Native Human Neutrophil Lactoferrin | +Inquiry |
Type II Collagen-01C | Native Chicken Type II Collagen | +Inquiry |
LukAB-733S | Native S. aureus LukA-LukB heterodimer Protein | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HYAL3-831HCL | Recombinant Human HYAL3 cell lysate | +Inquiry |
Cerebellum-65H | Human Cerebellum (LT) Membrane Lysate | +Inquiry |
ZNF385C-83HCL | Recombinant Human ZNF385C 293 Cell Lysate | +Inquiry |
IFT88-5271HCL | Recombinant Human IFT88 293 Cell Lysate | +Inquiry |
C12orf36-8322HCL | Recombinant Human C12orf36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zitB Products
Required fields are marked with *
My Review for All zitB Products
Required fields are marked with *
0
Inquiry Basket