Recombinant Full Length Salmonella Typhimurium Thiol:Disulfide Interchange Protein Dsbd(Dsbd) Protein, His-Tagged
Cat.No. : | RFL24021SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Thiol:disulfide interchange protein DsbD(dsbD) Protein (Q8ZKC3) (20-567aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-567) |
Form : | Lyophilized powder |
AA Sequence : | GLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQL PTGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTVTYQGCADAGFCYPPETKTVPLS EVAAAIDATPTPAVTQTSETSKPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLG GRQRLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLA LSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYI AQSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFL LERIIGEAWGLRLWSLLGVAFFGWAFITSLQARRAWMRIVQIILLAAALISVRPLQDWAF GSPSAQAPAHLNFTAISTVDELNQALAQAKGKPVMLDFYADWCVACKEFEKYTFSDPRVQ QALGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFNTQGQEQPQSRVTGFMDAATFS AHLHDRQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsbD |
Synonyms | dsbD; STM4323; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase |
UniProt ID | Q8ZKC3 |
◆ Recombinant Proteins | ||
RFL33511RF | Recombinant Full Length Rickettsia Conorii Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
EBI3-27028TH | Recombinant Human EBI3, His-tagged | +Inquiry |
MAPK14-356H | Recombinant Human MAPK14 protein, His-tagged | +Inquiry |
TNFRSF18-1786R | Recombinant Rhesus Monkey TNFRSF18 Protein, hIgG1-tagged | +Inquiry |
TARS2-16429M | Recombinant Mouse TARS2 Protein | +Inquiry |
◆ Native Proteins | ||
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
Staphylococcus aureus-01 | Native S. aureus Suspension (Wood 46 strain) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDRT4-7606HCL | Recombinant Human CDRT4 293 Cell Lysate | +Inquiry |
VKORC1L1-404HCL | Recombinant Human VKORC1L1 293 Cell Lysate | +Inquiry |
VPS11-1911HCL | Recombinant Human VPS11 cell lysate | +Inquiry |
MAB21L3-8174HCL | Recombinant Human C1orf161 293 Cell Lysate | +Inquiry |
PPM1G-2960HCL | Recombinant Human PPM1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dsbD Products
Required fields are marked with *
My Review for All dsbD Products
Required fields are marked with *
0
Inquiry Basket