Recombinant Full Length Salmonella Typhimurium Sensor Protein Uhpb(Uhpb) Protein, His-Tagged
Cat.No. : | RFL26981SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Sensor protein uhpB(uhpB) Protein (P27668) (1-500aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-500) |
Form : | Lyophilized powder |
AA Sequence : | MNTFFSRLITVVACFFIFSAAWFCLWSISLHLVERPELAALLFPFGLRLGLMLQCPRGYW PVLLGAEWLLVYWLAQEVALAHLPLLMIGSVLTLLPVALTSRYRHQRDWRTLLLQGAALT AAALLQSLPWLGQGEEAWNALLLTLTGGLTLAPICLVFWHYLTSTTWLPLGPSLVSQPVN WRGRHLIWYLLLFIVSLWLQLGLPAELSRFTPFCLALPIIALAWHYGWQGALIATLMNAI ALIASQTWHDHPVDLLLSLLAQSLTGLLLGAGIQRLRELNQSLQKELARNHRLAERLLET EESVRRDVARELHDDIGQTITAIRTQAGIVQRLAADNGGVKQSGQLIEQLSLGVYDAVRR LLGRLRPRQLDDLTLAQAIRSLLREMELESRGIVSHLDWRIDETALSESQRVTLFRVCQE GLNNIVKHANASAVTLQGWQQDERLMLVIEDDGSGLPPGSHQQGFGLTGMRERVSALGGT LTISCTHGTRVSVSLPQRYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uhpB |
Synonyms | uhpB; STM3789; Signal transduction histidine-protein kinase/phosphatase UhpB |
UniProt ID | P27668 |
◆ Recombinant Proteins | ||
YQEM-1656B | Recombinant Bacillus subtilis YQEM protein, His-tagged | +Inquiry |
SIRPA-8543H | Recombinant Human SIRPA protein, hFc-tagged | +Inquiry |
RFL7366PF | Recombinant Full Length Pectobacterium Carotovorum Subsp. Carotovorum Type Ii Secretion System Protein L(Outl) Protein, His-Tagged | +Inquiry |
DPF1-3304Z | Recombinant Zebrafish DPF1 | +Inquiry |
GRM7-8399Z | Recombinant Zebrafish GRM7 | +Inquiry |
◆ Native Proteins | ||
EPX-1862H | Native Human Eosinophil Peroxidase | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
Collagen-55B | Native Bovine Collagen Type II | +Inquiry |
Lectin-1764C | Active Native Succinylated Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
FABP3-10R | Native Rat FABP3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZRANB2-9190HCL | Recombinant Human ZRANB2 293 Cell Lysate | +Inquiry |
LY86-2892MCL | Recombinant Mouse LY86 cell lysate | +Inquiry |
PCDHGA11-1302HCL | Recombinant Human PCDHGA11 cell lysate | +Inquiry |
HDAC1-5608HCL | Recombinant Human HDAC1 293 Cell Lysate | +Inquiry |
NOP2-3764HCL | Recombinant Human NOP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uhpB Products
Required fields are marked with *
My Review for All uhpB Products
Required fields are marked with *
0
Inquiry Basket