Recombinant Full Length Salmonella Typhimurium Sensor Protein Qsec(Qsec) Protein, His-Tagged
Cat.No. : | RFL13313SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Sensor protein qseC(qseC) Protein (Q8ZLZ9) (1-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-449) |
Form : | Lyophilized powder |
AA Sequence : | MKLTQRLSLRVRLTLIFLILVSITWAISSFVAWRKTTDNVDELFDTQLMLFARRLSTLDL NEINAPQRMAHTPKKLKHGHIDDDALAFAIFSADGKMLLHDGDNGQDIPYRYRREGFDNG YLKDDNDLWRFLWLNSADGKYRIVVGQEWDYREDMALAIVAAQLTPWLIALPFMLLILLL LLHRELRPLKKLAQALRFRSPESETPLDAKGVPSEVRPLVEALNQLFSRIHSMMVRERRF TSDAAHELRSPLAALKVQTEVAQLSGDDPLSRDKALTQLHAGIDRATRLVDQLLTLSRLD SLNNLQDVAEISLEELLQSAVMDIYHPAQQANIDVRLQLNAHDVIRTGQPLLLSLLVRNL LDNAIRYSPQGSVVDVTLHARSFTVRDNGPGVAPEILTHIGERFYRPPGQSVTGSGLGLS IVRRIATLHGMTVSFGNAAEGGFEAVVSW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | qseC |
Synonyms | qseC; STM3178; Sensor protein QseC |
UniProt ID | Q8ZLZ9 |
◆ Native Proteins | ||
GG-192M | Native Mouse Gamma Globulin protein | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
CNAN-133A | Native Arachis hypogaea seed Conarachin | +Inquiry |
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
Lectin-1851U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 594 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC15-8346HCL | Recombinant Human C11orf51 293 Cell Lysate | +Inquiry |
PXMP4-519HCL | Recombinant Human PXMP4 lysate | +Inquiry |
ALOX15-8897HCL | Recombinant Human ALOX15 293 Cell Lysate | +Inquiry |
PGLYRP1-1873MCL | Recombinant Mouse PGLYRP1 cell lysate | +Inquiry |
CCDC70-7751HCL | Recombinant Human CCDC70 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All qseC Products
Required fields are marked with *
My Review for All qseC Products
Required fields are marked with *
0
Inquiry Basket