Recombinant Full Length Salmonella Typhimurium O-Antigen Ligase(Rfal) Protein, His-Tagged
Cat.No. : | RFL33206SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium O-antigen ligase(rfaL) Protein (P26471) (1-404aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-404) |
Form : | Lyophilized powder |
AA Sequence : | MLTTSLTLNKEKWKPIWNKALVFLFVATYFLDGITRYKHLIIILMVITAIYQVSRSPKSF PPLFKNSVFYSVAVLSLILVYSILISPDMKESFKEFENTVLEGFLLYTLLIPVLLKDETK ETVAKIVLFSFLTSLGLRCLAESILYIEDYNKGIMPFISYAHRHMSDSMVFLFPALLNIW LFRKNAIKLVFLVLSAIYLFFILGTLSRGAWLAVLIVGVLWAILNRQWKLIGVGAILLAI IGALVITQHNNKPDPEHLLYKLQQTDSSYRYTNGTQGTAWILIQENPIKGYGYGNDVYDG VYNKRVVDYPTWTFKESIGPHNTILYIWFSAGILGLASLVYLYGAIIRETASSTLRKVEI SPYNAHLLLFLSFVGFYIVRGNFEQVDIAQIGIITGFLLALRNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rfaL |
Synonyms | rfaL; rfbT; waaL; STM3713; O-antigen ligase |
UniProt ID | P26471 |
◆ Recombinant Proteins | ||
NSG1-6134C | Recombinant Chicken NSG1 | +Inquiry |
ROBO4-3792H | Recombinant Human ROBO4 protein, His-tagged | +Inquiry |
KATNA1-381C | Recombinant Cynomolgus Monkey KATNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cdk7-1925M | Recombinant Mouse Cdk7 protein, His-tagged | +Inquiry |
MAP1LC3A-3796H | Recombinant Human MAP1LC3A Protein (Met1-Phe121), C-His tagged | +Inquiry |
◆ Native Proteins | ||
CRP-8057H | Native C-Reactive Protein | +Inquiry |
Mucin-312 | Native Porcine Mucin Type II protein | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
INS-5435B | Native Bovine Insulin | +Inquiry |
IBVF0704-224I | Native Influenza (B/Florida 07/04 ) IBVF0704 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXC6-5416HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
WDFY2-1922HCL | Recombinant Human WDFY2 cell lysate | +Inquiry |
LPIN1-4668HCL | Recombinant Human LPIN1 293 Cell Lysate | +Inquiry |
ES-E14TG2a-574M | ES-E14TG2a (mouse pluripotent embryonic stem cell) whole cell lysate | +Inquiry |
GNB4-5860HCL | Recombinant Human GNB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rfaL Products
Required fields are marked with *
My Review for All rfaL Products
Required fields are marked with *
0
Inquiry Basket