Recombinant Full Length Salmonella Schwarzengrund Cobalt Transport Protein Cbin(Cbin) Protein, His-Tagged
Cat.No. : | RFL33763SF |
Product Overview : | Recombinant Full Length Salmonella schwarzengrund Cobalt transport protein CbiN(cbiN) Protein (B4TZQ1) (1-93aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella schwarzengrund |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-93) |
Form : | Lyophilized powder |
AA Sequence : | MKKTLMLLAMVVALVILPFFINHGGEYGGSDGEAESQIQAIAPQYKPWFQPLYEPASGEI ESLLFTLQGSLGAAVIFYILGYCKGKQRRDDRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cbiN |
Synonyms | cbiN; SeSA_A2191; Cobalt transport protein CbiN; Energy-coupling factor transporter probable substrate-capture protein CbiN |
UniProt ID | B4TZQ1 |
◆ Recombinant Proteins | ||
CYP17A1-2115H | Recombinant Human CYP17A1 protein, His & T7-tagged | +Inquiry |
INTS2-2423C | Recombinant Chicken INTS2 | +Inquiry |
BTNL2-10331H | Recombinant Human BTNL2, GST-tagged | +Inquiry |
TCTN1-9098M | Recombinant Mouse TCTN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A4-15327M | Recombinant Mouse SLC25A4 Protein | +Inquiry |
◆ Native Proteins | ||
C3-05M | Native Mouse C3 Protein | +Inquiry |
CSH1-31024TH | Native Human CSH1 | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
IgG-348G | Native Hamster Gamma Globulin Fraction | +Inquiry |
IgG-7439M | Native Mouse IgG Fc Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UVRAG-444HCL | Recombinant Human UVRAG 293 Cell Lysate | +Inquiry |
HA-881HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
PRKCB-2859HCL | Recombinant Human PRKCB 293 Cell Lysate | +Inquiry |
GINS3-5932HCL | Recombinant Human GINS3 293 Cell Lysate | +Inquiry |
CDH20-7637HCL | Recombinant Human CDH20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cbiN Products
Required fields are marked with *
My Review for All cbiN Products
Required fields are marked with *
0
Inquiry Basket