Recombinant Full Length Salmonella Paratyphi A Cobalamin Biosynthesis Protein Cbib(Cbib) Protein, His-Tagged
Cat.No. : | RFL30003SF |
Product Overview : | Recombinant Full Length Salmonella paratyphi A Cobalamin biosynthesis protein CbiB(cbiB) Protein (Q5PDS9) (1-319aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella paratyphi A |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-319) |
Form : | Lyophilized powder |
AA Sequence : | MTILAWCIAWVLDFIIGDPQHWPHPVRWIGRLITFVQRIVRRYCPGDKALRIGGGVMWVV VVGVTWGVAWGVLALAQRIHPWFGWSVEVWMIFTTLAGRSLARAAQEFERPLRENDLAES RIKLSWIVGRDTSQLQPAQINRAVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTL DSMVGYKHEKYRAIGMVSARMDDVANYLPARLSWLLLGIAAGLCRLSDWRALRIGWRDRY NHSSPNCAWSEACVAGALGIQLGGPNNYFGERVDKPWIGDAQRGISVDDISRTIRLMWVA STLALALFIAARCGLSGVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cbiB |
Synonyms | cbiB; SPA0837; Cobalamin biosynthesis protein CbiB |
UniProt ID | Q5PDS9 |
◆ Recombinant Proteins | ||
RPL28-3248H | Recombinant Human RPL28 protein, His-tagged | +Inquiry |
RFL14231HF | Recombinant Full Length Human C-C Chemokine Receptor Type 6(Ccr6) Protein, His-Tagged | +Inquiry |
ATF2-27043TH | Recombinant Human ATF2, His-tagged | +Inquiry |
TPRG1L-4924R | Recombinant Rhesus monkey TPRG1L Protein, His-tagged | +Inquiry |
AGPS-10465Z | Recombinant Zebrafish AGPS | +Inquiry |
◆ Native Proteins | ||
Collagen-317B | Native Bovine Collagen Type I | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
KLK3-8247H | Native Human Prostate Specific Antigen | +Inquiry |
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
IgG-356B | Native Bovine Gamma Globulin Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC87-7744HCL | Recombinant Human CCDC87 293 Cell Lysate | +Inquiry |
LZTS1-4574HCL | Recombinant Human LZTS1 293 Cell Lysate | +Inquiry |
PLIN3-3106HCL | Recombinant Human PLIN3 293 Cell Lysate | +Inquiry |
CYSTM1-8015HCL | Recombinant Human C5orf32 293 Cell Lysate | +Inquiry |
C7orf49-7964HCL | Recombinant Human C7orf49 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cbiB Products
Required fields are marked with *
My Review for All cbiB Products
Required fields are marked with *
0
Inquiry Basket