Recombinant Full Length Salmonella Heidelberg Upf0761 Membrane Protein Yihy(Yihy) Protein, His-Tagged
Cat.No. : | RFL11915SF |
Product Overview : | Recombinant Full Length Salmonella heidelberg UPF0761 membrane protein yihY(yihY) Protein (B4TBV9) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella Heidelberg |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yihY |
Synonyms | yihY; SeHA_C4351; UPF0761 membrane protein YihY |
UniProt ID | B4TBV9 |
◆ Recombinant Proteins | ||
EPS8-1488R | Recombinant Rhesus monkey EPS8 Protein, His-tagged | +Inquiry |
Flt4-281MAF488 | Recombinant Mouse Flt4 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
SAP055A-001-2033S | Recombinant Staphylococcus aureus (strain: 434, other: CA-MSSA) SAP055A_001 protein, His-tagged | +Inquiry |
AIFM2-9504H | Recombinant Human AIFM2 protein, GST-tagged | +Inquiry |
Rab7-5330M | Recombinant Mouse Rab7 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Cela1 -71R | Active Native Rat pancreatic elastase | +Inquiry |
Lectin-1782G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Biotinylated | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
IgA-251G | Native Goat Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFT20-5275HCL | Recombinant Human IFT20 293 Cell Lysate | +Inquiry |
EPHA7-2125MCL | Recombinant Mouse EPHA7 cell lysate | +Inquiry |
SDF2-545MCL | Recombinant Mouse SDF2 cell lysate | +Inquiry |
MFAP2-4351HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
ACP5-2809HCL | Recombinant Human ACP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yihY Products
Required fields are marked with *
My Review for All yihY Products
Required fields are marked with *
0
Inquiry Basket