Recombinant Full Length Salmonella Gallinarum Rhomboid Protease Glpg(Glpg) Protein, His-Tagged
Cat.No. : | RFL35012SF |
Product Overview : | Recombinant Full Length Salmonella gallinarum Rhomboid protease glpG(glpG) Protein (B5R7J1) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella gallinarum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glpG |
Synonyms | glpG; SG3915; Rhomboid protease GlpG; Intramembrane serine protease |
UniProt ID | B5R7J1 |
◆ Recombinant Proteins | ||
Dlgap4-2577M | Recombinant Mouse Dlgap4 Protein, Myc/DDK-tagged | +Inquiry |
ASB8-2341H | Recombinant Human ASB8, His-tagged | +Inquiry |
SP4-10475Z | Recombinant Zebrafish SP4 | +Inquiry |
ULK1-17831M | Recombinant Mouse ULK1 Protein | +Inquiry |
C11orf54-1278H | Recombinant Human C11orf54 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
B. afzelii-21 | Native Borrelia afzelii Antigen | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
Ovary-025H | Human Ovary Lysate, Total Protein | +Inquiry |
GPOSP-40 | Active Native Glycerol-3-phosphate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX3-1591HCL | Recombinant Human SNX3 293 Cell Lysate | +Inquiry |
SERBP1-1949HCL | Recombinant Human SERBP1 293 Cell Lysate | +Inquiry |
Temporal Lobe-505H | Human Temporal Lobe (Alzheimers Disease) Membrane Lysate | +Inquiry |
ROCK2-2255HCL | Recombinant Human ROCK2 293 Cell Lysate | +Inquiry |
ORAI2-3554HCL | Recombinant Human ORAI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All glpG Products
Required fields are marked with *
My Review for All glpG Products
Required fields are marked with *
0
Inquiry Basket