Recombinant Full Length Escherichia Coli O45:K1 Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL18530EF |
Product Overview : | Recombinant Full Length Escherichia coli O45:K1 Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (B7MHC2) (1-546aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-546) |
Form : | Lyophilized powder |
AA Sequence : | MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMPNRHKDKPLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGLPVEA WFDDFEIKPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIKADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLYIPEVYPDYCSEGM MVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELPELVYDSLRQGKYLQH SVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFLLVSRPEWGLMPGWLMAGGLIAWFV GWRKTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; ECS88_4285; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | B7MHC2 |
◆ Native Proteins | ||
IgA-7430M | Active Native Mouse IgA Kappa Protein | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Testosterone-01H | Native Human Testosterone | +Inquiry |
Ribulose-122S | Native Ribulose-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OCM-453HCL | Recombinant Human OCM lysate | +Inquiry |
CDADC1-7672HCL | Recombinant Human CDADC1 293 Cell Lysate | +Inquiry |
NAPRT1-1165HCL | Recombinant Human NAPRT1 cell lysate | +Inquiry |
C4orf32-8029HCL | Recombinant Human C4orf32 293 Cell Lysate | +Inquiry |
SPATS1-1529HCL | Recombinant Human SPATS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket