Recombinant Full Length Salmonella Choleraesuis Upf0442 Protein Yjjb(Yjjb) Protein, His-Tagged
Cat.No. : | RFL23389SF |
Product Overview : | Recombinant Full Length Salmonella choleraesuis UPF0442 protein yjjB(yjjB) Protein (Q57G59) (1-157aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella choleraesuis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-157) |
Form : | Lyophilized powder |
AA Sequence : | MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yjjB |
Synonyms | yjjB; SCH_4397; UPF0442 protein YjjB |
UniProt ID | Q57G59 |
◆ Recombinant Proteins | ||
TFF1-1435H | Recombinant Human TFF1 protein, His & GST-tagged | +Inquiry |
RAET1A-13883M | Recombinant Mouse RAET1A Protein | +Inquiry |
DHX58-760H | Recombinant Human DHX58 Protein, His (Fc)-Avi-tagged | +Inquiry |
MPXV-0423 | Recombinant Monkeypox Virus D6L Protein | +Inquiry |
RPL17-1217H | Recombinant Human RPL17 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMAA-4286HCL | Recombinant Human MMAA 293 Cell Lysate | +Inquiry |
LPAR2-4674HCL | Recombinant Human LPAR2 293 Cell Lysate | +Inquiry |
SPZ1-1483HCL | Recombinant Human SPZ1 293 Cell Lysate | +Inquiry |
ELK4-6628HCL | Recombinant Human ELK4 293 Cell Lysate | +Inquiry |
ZDHHC23-1971HCL | Recombinant Human ZDHHC23 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yjjB Products
Required fields are marked with *
My Review for All yjjB Products
Required fields are marked with *
0
Inquiry Basket