Recombinant Full Length Saccharum Officinarum Nad(P)H-Quinone Oxidoreductase Subunit 3, Chloroplastic(Ndhc) Protein, His-Tagged
Cat.No. : | RFL2469SF |
Product Overview : | Recombinant Full Length Saccharum officinarum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic(ndhC) Protein (Q6ENV8) (1-120aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Saccharum Officinarum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-120) |
Form : | Lyophilized powder |
AA Sequence : | MFLLHEYDIFWTFLIIASLIPILVFWISGLLAPVSEGPEKLSSYESGIEPMGGAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEWS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhC |
Synonyms | ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3 |
UniProt ID | Q6ENV8 |
◆ Recombinant Proteins | ||
Nptx2-2504R | Recombinant Rat Nptx2 Protein, His-tagged | +Inquiry |
EXOSC2-0727H | Recombinant Human EXOSC2 Protein (M1-G293), Tag Free | +Inquiry |
ALKBH1-319H | Recombinant Human ALKBH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCAF13-2219M | Recombinant Mouse DCAF13 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGAP26-2514H | Recombinant Human ARHGAP26 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
Lectin-1738S | Active Native Sambucus Nigra Lectin Protein, Fluorescein labeled | +Inquiry |
LDH-226H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
UBA52-140H | Native Bovine Ubiquitin, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCAMP5-576HCL | Recombinant Human SCAMP5 lysate | +Inquiry |
UBE2K-571HCL | Recombinant Human UBE2K 293 Cell Lysate | +Inquiry |
APITD1-8794HCL | Recombinant Human APITD1 293 Cell Lysate | +Inquiry |
GSR-757HCL | Recombinant Human GSR cell lysate | +Inquiry |
CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ndhC Products
Required fields are marked with *
My Review for All ndhC Products
Required fields are marked with *
0
Inquiry Basket