Recombinant Full Length Nad(P)H-Quinone Oxidoreductase Subunit 3, Chloroplastic(Ndhc) Protein, His-Tagged
Cat.No. : | RFL20105AF |
Product Overview : | Recombinant Full Length NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic(ndhC) Protein (Q70XZ8) (1-120aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Amborella trichopoda |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-120) |
Form : | Lyophilized powder |
AA Sequence : | MFLLHEYDIFWAFLMISSVIPILAFLISGVLAPISQGPEKVSSYESGIEPMGDAWIQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLIPIVGSVYAWRKGALEWS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhC |
Synonyms | ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3 |
UniProt ID | Q70XZ8 |
◆ Recombinant Proteins | ||
RFL36180HF | Recombinant Full Length Human Claudin-20(Cldn20) Protein, His-Tagged | +Inquiry |
ZFP423-6331R | Recombinant Rat ZFP423 Protein, His (Fc)-Avi-tagged | +Inquiry |
STX7-5476R | Recombinant Rat STX7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fgf23-417M | Recombinant Mouse Fibroblast Growth Factor 23, Fc Chimera | +Inquiry |
USP42-9967M | Recombinant Mouse USP42 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
PKLR-244R | Active Native Rabbit Pyruvate Kinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG3A-1326RCL | Recombinant Rat REG3A cell lysate | +Inquiry |
TMEM132B-674HCL | Recombinant Human TMEM132B lysate | +Inquiry |
IL1R2-1108HCL | Recombinant Human IL1R2 cell lysate | +Inquiry |
PRKAR1A-1009HCL | Recombinant Human PRKAR1A cell lysate | +Inquiry |
SEPT5-1957HCL | Recombinant Human SEPT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhC Products
Required fields are marked with *
My Review for All ndhC Products
Required fields are marked with *
0
Inquiry Basket