Recombinant Full Length Saccharomyces Cerevisiae Vacuolar Membrane Protein Vin13_4115 (Vin13_4115) Protein, His-Tagged
Cat.No. : | RFL22480SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Vacuolar membrane protein VIN13_4115 (VIN13_4115) Protein (E7LZK9) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MVKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGA TSSSSLIVASITPPSTAGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSSYLSR RFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAAS PFNPIQDPFTDXRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEE ERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAP SMFLDDVLNGREII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VIN13_4115 |
Synonyms | VIN13_4115; Vacuolar membrane protein VIN13_4115 |
UniProt ID | E7LZK9 |
◆ Recombinant Proteins | ||
NHLRC1-1291H | Recombinant Human NHLRC1, GST-tagged | +Inquiry |
Mccc1-8173M | Recombinant Mouse Mccc1 protein, His & T7-tagged | +Inquiry |
SLC45A4-8381M | Recombinant Mouse SLC45A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
LTBP1-319H | Recombinant Human LTBP1 Protein, His-tagged | +Inquiry |
GAL-3801H | Recombinant Human GAL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
CA-242-380H | Active Native Human Cancer Antigen 242 | +Inquiry |
Lectin-1735P | Active Native Peanut Agglutinin Protein, Rhodamine labeled | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
Hp-8155M | Native Mouse Serum Haptoglobin | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEDD4-3886HCL | Recombinant Human NEDD4 293 Cell Lysate | +Inquiry |
TAGLN3-1260HCL | Recombinant Human TAGLN3 293 Cell Lysate | +Inquiry |
SPCS3-1525HCL | Recombinant Human SPCS3 293 Cell Lysate | +Inquiry |
Testis-733P | Pig Testis Lysate, Total Protein | +Inquiry |
EIF4G2-6646HCL | Recombinant Human EIF4G2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VIN13_4115 Products
Required fields are marked with *
My Review for All VIN13_4115 Products
Required fields are marked with *
0
Inquiry Basket