Recombinant Human LTBP1 Protein, His-tagged

Source :	E. coli
Species :	Human
Tag :	His
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Protein length :	600-739 aa
AA Sequence :	CSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCH
Purity :	95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Name	LTBP1 latent transforming growth factor beta binding protein 1 [ Homo sapiens ]
Official Symbol	LTBP1
Synonyms	LTBP1; latent transforming growth factor beta binding protein 1; latent-transforming growth factor beta-binding protein 1; TGF beta1 BP 1; LTBP-1; TGF-beta1-BP-1; transforming growth factor beta-1-binding protein 1; MGC163161;
Gene ID	4052
mRNA Refseq	NM_000627
Protein Refseq	NP_000618
MIM	150390
UniProt ID	Q14766