Recombinant Full Length Saccharomyces Cerevisiae Vacuolar Membrane Protein Fosterso_4058 (Fosterso_4058) Protein, His-Tagged
Cat.No. : | RFL31738SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Vacuolar membrane protein FOSTERSO_4058 (FOSTERSO_4058) Protein (E7NMC3) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MXKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGX TSSSSLIVASITPPSTVGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSXYLSR RFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAAS PFNPIQDPFTDNRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEE ERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAP SMFLDDVLNGREII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FOSTERSO_4058 |
Synonyms | FOSTERSO_4058; Vacuolar membrane protein FOSTERSO_4058 |
UniProt ID | E7NMC3 |
◆ Recombinant Proteins | ||
EDIL3-12281H | Recombinant Human EDIL3, GST-tagged | +Inquiry |
ADCYAP1R1-3708C | Recombinant Chicken ADCYAP1R1 | +Inquiry |
AYP1020-RS10045-4818S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS10045 protein, His-tagged | +Inquiry |
AK4-27152TH | Recombinant Human AK4, His-tagged | +Inquiry |
IBVM0212-232I | Recombinant Influenza (B/Massachusetts 02/2012) IBVM0212 protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1718P | Native Peanut Lectin, PE conjugated | +Inquiry |
EDN2-8310H | Native Human EDN2 | +Inquiry |
Protein S-90H | Native Human Protein S | +Inquiry |
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
Lectin-1816P | Active Native Peanut Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Eye-722P | Pig Eye, Whole Lysate, Total Protein | +Inquiry |
NUDT14-446HCL | Recombinant Human NUDT14 lysate | +Inquiry |
MTMR7-4073HCL | Recombinant Human MTMR7 293 Cell Lysate | +Inquiry |
TSSK4-710HCL | Recombinant Human TSSK4 lysate | +Inquiry |
TDRD3-1756HCL | Recombinant Human TDRD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOSTERSO_4058 Products
Required fields are marked with *
My Review for All FOSTERSO_4058 Products
Required fields are marked with *
0
Inquiry Basket