Recombinant Full Length Saccharomyces Cerevisiae Vacuolar Membrane Protein Fostersb_4073 (Fostersb_4073) Protein, His-Tagged
Cat.No. : | RFL35254SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Vacuolar membrane protein FOSTERSB_4073 (FOSTERSB_4073) Protein (E7Q8M6) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MVKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGA TSSSSLIVASITPPSTAGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSXYLSR RFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAAS PFNPIQDPFTDNRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEE ERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAP SMFLDDVLNGREII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FOSTERSB_4073 |
Synonyms | FOSTERSB_4073; Vacuolar membrane protein FOSTERSB_4073 |
UniProt ID | E7Q8M6 |
◆ Recombinant Proteins | ||
SLC25A45-15333M | Recombinant Mouse SLC25A45 Protein | +Inquiry |
RFL33650YF | Recombinant Full Length Universal Stress Protein B(Uspb) Protein, His-Tagged | +Inquiry |
CD40LG-33H | Active Recombinant Human CD40LG, HIgG1 Fc-tagged | +Inquiry |
CCL19-4360R | Recombinant Rabbit CCL19 Protein | +Inquiry |
CYS4-2645B | Recombinant Baker's yeast CYS4 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
Hld-730S | Active Native S. aureus delta Hemolysin Protein | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1849U | Active Native Ulex Europaeus Agglutinin I Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBC1D2-1739HCL | Recombinant Human TBC1D2 cell lysate | +Inquiry |
HeLa-040HCL | Human TNFa Stimulated HeLa Whole Cell Lysate | +Inquiry |
CDH7-7635HCL | Recombinant Human CDH7 293 Cell Lysate | +Inquiry |
Liver-754B | Bovine Liver Membrane Lysate, Total Protein | +Inquiry |
SSBP2-1464HCL | Recombinant Human SSBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOSTERSB_4073 Products
Required fields are marked with *
My Review for All FOSTERSB_4073 Products
Required fields are marked with *
0
Inquiry Basket