Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Protein Ynl146W (Ynl146W) Protein, His-Tagged
Cat.No. : | RFL9700SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized protein YNL146W (YNL146W) Protein (P53906) (1-100aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-100) |
Form : | Lyophilized powder |
AA Sequence : | MSNTKHTTSHHMELKRIIILTLLFILIMLIFRNSVSFKMTFQELLPRFYKKNSNSVSNNN RPSSIFSENLVDFDDVNMVDKTRLFIFLFFSFIITIPFMV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YNL146W |
Synonyms | YNL146W; N1203; N1785; Uncharacterized protein YNL146W |
UniProt ID | P53906 |
◆ Native Proteins | ||
F2-73R | Native Rat Prothrombin | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
CPA-01B | Native Bovine Pancreas Carboxypeptidase A, Type II-PMSF treated | +Inquiry |
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPB2-1616HCL | Recombinant Human SNRPB2 293 Cell Lysate | +Inquiry |
IDH1-5307HCL | Recombinant Human IDH1 293 Cell Lysate | +Inquiry |
MAPK10-4499HCL | Recombinant Human MAPK10 293 Cell Lysate | +Inquiry |
C20orf7-8111HCL | Recombinant Human C20orf7 293 Cell Lysate | +Inquiry |
AKAP5-8939HCL | Recombinant Human AKAP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YNL146W Products
Required fields are marked with *
My Review for All YNL146W Products
Required fields are marked with *
0
Inquiry Basket