Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Mitochondrial Carrier Awri1631_61110 (Awri1631_61110) Protein, His-Tagged
Cat.No. : | RFL33766SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized mitochondrial carrier AWRI1631_61110 (AWRI1631_61110) Protein (B5VI70) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MANQNSDLYKQITAGSVAAVFQTTMTYPFEYLKTGLQLQPKGTAFEIILPQIKSYFVGCS ALNVAAFGKTILRFVTFDKLCHSLNNNIDNNDNFQRLTGYNLLIAGTLTGIVESLFIIPF ENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHNVATKSTPVARIEKLLPAVKHMYETRGP AAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSVITGLATSFTLVAMTQPID VVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQVS LLLGFSSRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AWRI1631_61110 |
Synonyms | AWRI1631_61110; Uncharacterized mitochondrial carrier AWRI1631_61110 |
UniProt ID | B5VI70 |
◆ Recombinant Proteins | ||
Gtpbp10-3332M | Recombinant Mouse Gtpbp10 Protein, Myc/DDK-tagged | +Inquiry |
KLF12-602H | Recombinant Human Kruppel-like factor 12, His-tagged | +Inquiry |
SUC-0007-4316S | Recombinant Staphylococcus aureus (strain: 18806) SUC_0007 protein, His-tagged | +Inquiry |
FBXO31-2294R | Recombinant Rat FBXO31 Protein | +Inquiry |
SIRT7-21H | Recombinant Human SIRT7 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-185H | Native Human Low Density Lipoprotein, acetylated, DiI | +Inquiry |
Thrombin-24H | Active Native Human a-Thrombin | +Inquiry |
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
IgG-019R | Native Rat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM125A-6438HCL | Recombinant Human FAM125A 293 Cell Lysate | +Inquiry |
SmallIntestine-497C | Chicken Small Intestine Lysate, Total Protein | +Inquiry |
BAI3-8523HCL | Recombinant Human BAI3 293 Cell Lysate | +Inquiry |
RBBP6-1480HCL | Recombinant Human RBBP6 cell lysate | +Inquiry |
USP13-472HCL | Recombinant Human USP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AWRI1631_61110 Products
Required fields are marked with *
My Review for All AWRI1631_61110 Products
Required fields are marked with *
0
Inquiry Basket