Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Membrane Protein Ydl133W(Ydl133W) Protein, His-Tagged
Cat.No. : | RFL21953SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized membrane protein YDL133W(YDL133W) Protein (Q12516) (1-437aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-437) |
Form : | Lyophilized powder |
AA Sequence : | MGDSNSSQEAYSDTTSTNASRIADQNQLNLNVDLEKNQTVRKSGSLEALQNAKIHVPKHS DGSPLDYPKLNTYTFVPTTVPPYVLEAQFDKLRLQDKGTVDGNVTDDKNLPKEFKWGQFA STIGCHSAYTRDQNYNPSHKSYDGYSLSSSTSSKNAALREILGDMCSEWGGEERLEGVLH SEIGANLEFNTTEERKEWLQYIEKVKDFYYGDNKKNPESPESVHNKVYKSDWVNELNKER EKWRRLKQRKLQQWRPPLTSLLLDNQYLILGLRIFTGILSCISLALAIKIFQNSRSNNTI SESKIGQQPSTIMAICVNAVAIAYIIYIAHDEFAGKPVGLRNPLSKLKLILLDLLFIIFS SANLALAFNTRFDKEWVCTSIRRSNGSTYGYPKIPRICRKQEALSAFLFVALFMWVITFS ISIVRVVEKVSSITNRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SRF1 |
Synonyms | SRF1; YDL133W; D2185; Regulator of phospholipase D SRF1; SPO14 regulatory factor 1 |
UniProt ID | Q12516 |
◆ Recombinant Proteins | ||
Sfrp1-365M | Recombinant Mouse Sfrp1 Protein, His-tagged | +Inquiry |
Pla2g12a-4794M | Recombinant Mouse Pla2g12a protein, His&Myc-tagged | +Inquiry |
ARCN1A-11505Z | Recombinant Zebrafish ARCN1A | +Inquiry |
STEAP4-5786R | Recombinant Rat STEAP4 Protein | +Inquiry |
SCO7611-1417S | Recombinant Streptomyces coelicolor A3(2) SCO7611 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CSH1-31024TH | Native Human CSH1 | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
GFAP-18P | Native Porcine GFAP Protein | +Inquiry |
PDHB-1860B | Native Bovine Pyruvate Dehydrogenase (lipoamide) Beta | +Inquiry |
HP-191E | Native Equine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CGA-001HCL | Recombinant Human CGA cell lysate | +Inquiry |
CYB5R4-7140HCL | Recombinant Human CYB5R4 293 Cell Lysate | +Inquiry |
HA-2370HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
PRRC1-508HCL | Recombinant Human PRRC1 lysate | +Inquiry |
CCRL2-311HCL | Recombinant Human CCRL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SRF1 Products
Required fields are marked with *
My Review for All SRF1 Products
Required fields are marked with *
0
Inquiry Basket