Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Acyltransferase Cst26(Cst26) Protein, His-Tagged
Cat.No. : | RFL12397SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized acyltransferase CST26(CST26) Protein (P38226) (1-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-397) |
Form : | Lyophilized powder |
AA Sequence : | MLHQKIAHKVRKVVVPGISLLIFFQGCLILLFLQLTYKTLYCRNDIRKQIGLNKTKRLFI VLVSSILHVVAPSAVRITTENSSVPKGTFFLDLKKKRILSHLKSNSVAICNHQIYTDWIF LWWLAYTSNLGANVFIILKKSLASIPILGFGMRNYNFIFMSRKWAQDKITLSNSLAGLDS NARGAGSLAGKSPERITEEGESIWNPEVIDPKQIHWPYNLILFPEGTNLSADTRQKSAKY AAKIGKKPFKNVLLPHSTGLRYSLQKLKPSIESLYDITIGYSGVKQEEYGELIYGLKSIF LEGKYPKLVDIHIRAFDVKDIPLEDENEFSEWLYKIWSEKDALMERYYSTGSFVSDPETN HSVTDSFKINRIELTEVLILPTLTIIWLVYKLYCFIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CST26 |
Synonyms | CST26; PSI1; YBR042C; YBR0412; 2-acyl-1-lysophosphatidylinositol acyltransferase; Acyl-CoA:lyso-PI acyltransferase; Chromosome stability protein 26; Phosphatidylinositol stearoyl incorporating protein 1 |
UniProt ID | P38226 |
◆ Native Proteins | ||
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
Lectin-1861W | Active Native Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
Lectin-1792A | Active Native Artocarpus integrifolia Jacalin Protein, Agarose bound | +Inquiry |
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM179B-902HCL | Recombinant Human FAM179B cell lysate | +Inquiry |
PDZK1IP1-3313HCL | Recombinant Human PDZK1IP1 293 Cell Lysate | +Inquiry |
TRIM48-771HCL | Recombinant Human TRIM48 293 Cell Lysate | +Inquiry |
TMEM11-1013HCL | Recombinant Human TMEM11 293 Cell Lysate | +Inquiry |
ANKRD49-8848HCL | Recombinant Human ANKRD49 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CST26 Products
Required fields are marked with *
My Review for All CST26 Products
Required fields are marked with *
0
Inquiry Basket