Recombinant Full Length Saccharomyces Cerevisiae Topoisomerase I Damage Affected Protein 7(Tda7) Protein, His-Tagged
Cat.No. : | RFL30101SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Topoisomerase I damage affected protein 7(TDA7) Protein (E7NM81) (1-636aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-636) |
Form : | Lyophilized powder |
AA Sequence : | MNSNSTIGRTTLGESDTISLSFSEPSSSLNSRSTDVVFASTSTLVPQQGSLTSLPPVSST ATPTYYSTSLTYDETLHTSIDVSSTSTLVSSTDSSSSSEQDTYSSQYDPATSSYSIITPS MSIFSSTSPMSSSSSITSEWSSLTSTTPTLSXSATSLSSSWSSLSSPSSLLVSSSLSLSL SSSYSDTKLFSFDSRSSIFSPSTPTVISPSYTYLSSISATSFQISTTSELSXSWFSTISS PSTTSNKDTTFPSSSRNTSTSFYSSSLSSTNDFSTISKSSKLSPSASSSTVSISTISVPT SSSVSSSSSKVPSNRPSSSSSSDDTTSAYSSTYTFQSLQSTTSSSIPPXTQTPSTSTIST SPIPTSSQVFNTXAISSSEDSKTIYYFYTQTYDITDSSTTFVTGLPTTIAVAKSEVTSFS APSSTITADMSFYQHWLDGSLDNNKNQGTSKTNTGTIVGSVVGSVGGILICVLVVWFMLV RKRKAKRHFKENDSFCHEIGRRTGFPTTAQAKEASLQAQDSGSQQRNTETASANNPFSNE FNFKARGNPPPVPPPRNVTAXNGSFQNMRSNFMDQENRFSYGSSFTYSSLGSSTQGGFST LSSNSIRLGXGLDNDISHDERNTVQNNSQGFLREII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TDA7 |
Synonyms | TDA7; FOSTERSO_3962; Topoisomerase I damage affected protein 7 |
UniProt ID | E7NM81 |
◆ Recombinant Proteins | ||
RABGAP1-2140H | Recombinant Human RABGAP1, GST-tagged | +Inquiry |
RFL19789HF | Recombinant Full Length Human Transmembrane Protein 74B(Tmem74B) Protein, His-Tagged | +Inquiry |
CHMP2A-1249H | Recombinant Human CHMP2A Protein, GST-Tagged | +Inquiry |
IL34-3046R | Recombinant Rat IL34 Protein | +Inquiry |
STS-1272HFL | Recombinant Full Length Human STS Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
ALPP-8347H | Native Human ALPP | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
ALB-4783D | Native Dog Albumin | +Inquiry |
BCHE-8E | Active Native Equine Butyrylcholine esterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP17A-1591HCL | Recombinant Human AKAP17A cell lysate | +Inquiry |
COL2A1-2063HCL | Recombinant Human COL2A1 cell lysate | +Inquiry |
IL18R1-001CCL | Recombinant Cynomolgus IL18R1 cell lysate | +Inquiry |
GSC-5728HCL | Recombinant Human GSC 293 Cell Lysate | +Inquiry |
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TDA7 Products
Required fields are marked with *
My Review for All TDA7 Products
Required fields are marked with *
0
Inquiry Basket