Recombinant Full Length Saccharomyces Cerevisiae Topoisomerase I Damage Affected Protein 7(Tda7) Protein, His-Tagged
Cat.No. : | RFL20408SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Topoisomerase I damage affected protein 7(TDA7) Protein (B3LP27) (1-636aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-636) |
Form : | Lyophilized powder |
AA Sequence : | MNSNSTIGRTTLGESDTISLSFSEPSSSLNSRSTDVVFASTSTLVPQQGSLTSLPPVSST ATPTYYSTSLTYDETLHTSIDVSSTSTLVSSTDSSSSSEQDTYSSQYDPATSSYSIITPS MSIFSSTSPMSSSSSITSEWSSLTSTTPTLSSSATSLSSSWSSLSSPSSLLVSSSLSLSL SSSYSDTKLFSFDSRSSIFSPSTPTVISPSYTYLSSISATSFQISTTSELSSSWFSTISS PSTTSNKDTTFPSSSRNTSTSFYSSSLSSTNDFSTISKSSKLSPSASSSTVSISTISVPT SSSVSSSSSKVPSNRPSSSSSSDDTTSAYSSTYTFQSLQSTTSSSIPPTTQTPSTSTIST SPIPTSSQVFNTVAISSSEDSKTIYYFYTQTYDITDSSTTFVTGLPTTIAVAKSEVTSFS APSSTITADMSFYQHWLDGSLDNNKNQGTSKTNTGTIVGSVVGSVGGILICVLVVWFMLV RKRKAKRHFKENDSFCHEIGRRTGFPTTAQAKEASLQAQDSGSQQRNTETASANNPFSNE FNFKARGNPPPVPPPRNVTAMNGSFQNMRSNFMDQENRFSYGSSFTYSSLGSSTQGGFST LSSNSIRLGRGLDNDISHDERNTVQNNSQGFLREII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TDA7 |
Synonyms | TDA7; SCRG_03307; Topoisomerase I damage affected protein 7 |
UniProt ID | B3LP27 |
◆ Recombinant Proteins | ||
CORO7-3803M | Recombinant Mouse CORO7 Protein | +Inquiry |
MYLIP-1933C | Recombinant Chicken MYLIP | +Inquiry |
RFL19047YF | Recombinant Full Length Yersinia Enterocolitica Protein Yopb(Yopb) Protein, His-Tagged | +Inquiry |
RFL30848GF | Recombinant Full Length Chicken Ectonucleoside Triphosphate Diphosphohydrolase 5(Entpd5) Protein, His-Tagged | +Inquiry |
KLRK1-4905H | Recombinant Human KLRK1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MMP7-28205TH | Native Human MMP7 | +Inquiry |
Chitosan-004C | Native Crawfish Chitosan Film | +Inquiry |
Avidin-015 | Native Avidin Protein, Peroxidase conjugated | +Inquiry |
Skin-008H | Human Skin Lysate, Total Protein | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM46-2467HCL | Recombinant Human RBM46 293 Cell Lysate | +Inquiry |
AOC2-8822HCL | Recombinant Human AOC2 293 Cell Lysate | +Inquiry |
TMEM50A-946HCL | Recombinant Human TMEM50A 293 Cell Lysate | +Inquiry |
MECR-4394HCL | Recombinant Human MECR 293 Cell Lysate | +Inquiry |
FBXO27-6302HCL | Recombinant Human FBXO27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDA7 Products
Required fields are marked with *
My Review for All TDA7 Products
Required fields are marked with *
0
Inquiry Basket