Recombinant Human KLRK1 Protein, GST-tagged

Description :	Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. This gene encodes a member of the NKG2 family, and the encoded transmembrane protein is characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	51.7 kDa
AA Sequence :	MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	KLRK1 killer cell lectin-like receptor subfamily K, member 1 [ Homo sapiens ]
Official Symbol	KLRK1
Synonyms	KLRK1; killer cell lectin-like receptor subfamily K, member 1; D12S2489E, DNA segment on chromosome 12 (unique) 2489 expressed sequence; NKG2-D type II integral membrane protein; CD314; KLR; NKG2 D; NKG2D; NK cell receptor D; NKG2-D-activating NK receptor; NKG2-D; D12S2489E; FLJ17759; FLJ75772;
Gene ID	22914
mRNA Refseq	NM_007360
Protein Refseq	NP_031386
MIM	611817
UniProt ID	P26718