Recombinant Full Length Saccharomyces Cerevisiae Sphingosine N-Acyltransferase Lac1(Lac1) Protein, His-Tagged
Cat.No. : | RFL23183SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Sphingosine N-acyltransferase LAC1(LAC1) Protein (P28496) (1-418aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-418) |
Form : | Lyophilized powder |
AA Sequence : | MSTIKPSPSNNNLKVRSRPRRKSSIGKIDLGDTVPSLGTMFETKESKTAAKRRMQRLSEA TKNDSDLVKKIWFSFREISYRHAWIAPLMILIAVYSAYFTSGNTTKTNVLHRFVAVSYQI GDTNAYGKGINDLCFVFYYMIFFTFLREFLMDVVIRPFAIRLHVTSKHRIKRIMEQMYAI FYTGVSGPFGIYCMYHSDLWFFNTKAMYRTYPDFTNPFLFKVFYLGQAAFWAQQACILVL QLEKPRKDHNELTFHHIVTLLLIWSSYVFHFTKMGLPIYITMDVSDFLLSFSKTLNYLDS GLAFFSFAIFVVAWIYLRHYINLKILWSVLTQFRTEGNYVLNFATQQYKCWISLPIVFVL IGALQLVNLYWLFLIFRVLYRILWRGILKDDRSDSESDEESDESSTTPTDSTPTKKDI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LAC1 |
Synonyms | LAC1; DGT1; YKL008C; YKL156; Ceramide synthase LAC1; Very-long-chain ceramide synthase LAC1 |
UniProt ID | P28496 |
◆ Recombinant Proteins | ||
PSAP-30115H | Recombinant Human PSAP protein, GST-tagged | +Inquiry |
FGFR4-614H | Active Recombinant Human FGFR4, Fc-tagged, Biotinylated | +Inquiry |
SCO1749-1461S | Recombinant Streptomyces coelicolor A3(2) SCO1749 protein, His-tagged | +Inquiry |
MX1-10269M | Recombinant Mouse MX1 Protein | +Inquiry |
Y66D12A.8-8247Z | Recombinant Zebrafish Y66D12A.8 | +Inquiry |
◆ Native Proteins | ||
FSME-08 | Native FSME (TBE) Virus Antigen (Premium) | +Inquiry |
Plg-32M | Native Mouse Plg protein | +Inquiry |
KLK3-8248H | Native Human Prostate Specific Antigen | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1orf51-8156HCL | Recombinant Human C1orf51 293 Cell Lysate | +Inquiry |
PHF23-3228HCL | Recombinant Human PHF23 293 Cell Lysate | +Inquiry |
LIPF-001HCL | Recombinant Human LIPF cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
FMO1-282HCL | Recombinant Human FMO1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAC1 Products
Required fields are marked with *
My Review for All LAC1 Products
Required fields are marked with *
0
Inquiry Basket