Active Recombinant Human FGFR4, Fc-tagged, Biotinylated

• Cat.No.: FGFR4-614H
• Product Overview: The recombinant human FGFR4 ECD is expressed as a 577 amino acid protein consisting of Leu22 - Asp369 region of FGFR4 (Uniprot accession #P22455 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule)
• Bio-activity: Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED50 of 0.01 - 0.05 μg/ml
• Molecular Mass: Calculated molecular mass (kDa): 64.1; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
• AA Sequence: LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPED AGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVK FRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLE RSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEV LYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTAAAPEARYTDGSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 22-369 a.a.

Gene Information

• Gene Name: FGFR4 fibroblast growth factor receptor 4 [ Homo sapiens ]
• Official Symbol: FGFR4
• Synonyms: FGFR4; fibroblast growth factor receptor 4; CD334; JTK2; FGFR-4; tyrosylprotein kinase; protein-tyrosine kinase; hydroxyaryl-protein kinase; tyrosine kinase related to fibroblast growth factor receptor; TKF; MGC20292
• Gene ID: 2264
• mRNA Refseq: NM_002011
• Protein Refseq: NP_002002
• MIM: 134935
• UniProt ID: P22455
• Chromosome Location: 5q33-qter
• Pathway: Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR4 ligand binding and activation, organism-specific biosystem; FRS2-mediated cascade, organism-specific biosystem
• Function: ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor 2 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein tyrosine kinase activity; receptor activity