Recombinant Full Length Saccharomyces Cerevisiae Sphingoid Long-Chain Base Transporter Rsb1(Rsb1) Protein, His-Tagged
Cat.No. : | RFL392SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Sphingoid long-chain base transporter RSB1(RSB1) Protein (C7GLH7) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MSNATNNTLGSLLPQLEAAANSNSLYGGMVPNLRFNITMIVIWGILLTIHVVQLLMRQYW FSIAFICTGILEVLGFIGRTWSHSNVADMDAFLLNMICLTIAPVFTMGGIYYQLAKLIEV YGHRFSLLPSPMAYSFIFICSDIVSLVVQAVGGGLCGVAVTDGTSTTTGNHVFIAGLAIQ VASMAIFLMLWFHFLFRIYISVRWEHINSRPISLSLLKISQTEVDYLYREKFHFLRLEPK RWVFHYFNLAITVAVLTIFTRCCYRLAELVVGWDGYLITHEWYFIILDALMMAIATVTLT IFHPGFAFKGKSTSIPITPGHVDPETLPHTDDVEDILDTSDSKQFDIEKEEFQASMKYPI STFKQFMSKIANLFSSKKKAKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RSB1 |
Synonyms | RSB1; C1Q_01055; Sphingoid long-chain base transporter RSB1 |
UniProt ID | C7GLH7 |
◆ Native Proteins | ||
CTSH-360H | Native Human Eosinophil Peroxidase | +Inquiry |
Lectin-1816P | Active Native Peanut Lectin Protein, Fluorescein labeled | +Inquiry |
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AAK1-2106HCL | Recombinant Human AAK1 cell lysate | +Inquiry |
C7orf34-128HCL | Recombinant Human C7orf34 lysate | +Inquiry |
NUP85-3628HCL | Recombinant Human NUP85 293 Cell Lysate | +Inquiry |
C1orf94-8144HCL | Recombinant Human C1orf94 293 Cell Lysate | +Inquiry |
MAPK4-4493HCL | Recombinant Human MAPK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RSB1 Products
Required fields are marked with *
My Review for All RSB1 Products
Required fields are marked with *
0
Inquiry Basket