Recombinant Full Length Saccharomyces Cerevisiae Putative Uncharacterized Protein Ypr126C (Ypr126C) Protein, His-Tagged
Cat.No. : | RFL17524SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Putative uncharacterized protein YPR126C (YPR126C) Protein (O13567) (1-102aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-102) |
Form : | Lyophilized powder |
AA Sequence : | MLARVAESVSCGLMGQVKTGLLLFDGSGFSDRLGVMRFYVWSSRIYVLVLVVQAQLILDA HNGVLFLLLFFLHNFFLLPQLFQFLLSGCLIFLNDVYFNLMV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YPR126C |
Synonyms | YPR126C; P9642.2B; Putative uncharacterized protein YPR126C |
UniProt ID | O13567 |
◆ Native Proteins | ||
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
TnI-1050H | Native Human Cardiac Troponin I | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAL3ST1-6046HCL | Recombinant Human GAL3ST1 293 Cell Lysate | +Inquiry |
GLTP-5893HCL | Recombinant Human GLTP 293 Cell Lysate | +Inquiry |
ANKS3-26HCL | Recombinant Human ANKS3 lysate | +Inquiry |
TNNC1-885HCL | Recombinant Human TNNC1 293 Cell Lysate | +Inquiry |
OR6B2-1257HCL | Recombinant Human OR6B2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YPR126C Products
Required fields are marked with *
My Review for All YPR126C Products
Required fields are marked with *
0
Inquiry Basket