Recombinant Full Length Saccharomyces Cerevisiae Putative Increased Recombination Centers Protein 13(Irc13) Protein, His-Tagged
Cat.No. : | RFL4591SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Putative increased recombination centers protein 13(IRC13) Protein (Q08630) (1-104aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-104) |
Form : | Lyophilized powder |
AA Sequence : | MGLYRPSKFFHPPIPHIPFTINPDFFSFHIQRLKAKANPENFLICFPPPDIYKGFVFCCQ LDLVHLFSYVFFLFLLKICVDVLQYVIYPKHFTHKKPGFENYSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IRC13 |
Synonyms | IRC13; YOR235W; Increased recombination centers protein 13 |
UniProt ID | Q08630 |
◆ Native Proteins | ||
Lectin-1847S | Active Native Soybean Agglutinin Protein, Fluorescein labeled | +Inquiry |
pepsin -173P | Native Pig pepsin | +Inquiry |
Artery-015H | Human Artery Lysate, Total Protein | +Inquiry |
SOD-45B | Active Native Bovine Superoxide dismutase | +Inquiry |
CPB-01P | Native Porcine Carboxypeptidase B | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
IFNGR1-1175RCL | Recombinant Rat IFNGR1 cell lysate | +Inquiry |
SLC6A15-1706HCL | Recombinant Human SLC6A15 293 Cell Lysate | +Inquiry |
CLPS-419HCL | Recombinant Human CLPS cell lysate | +Inquiry |
RB1CC1-2490HCL | Recombinant Human RB1CC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All IRC13 Products
Required fields are marked with *
My Review for All IRC13 Products
Required fields are marked with *
0
Inquiry Basket