Recombinant Full Length Saccharomyces Cerevisiae Protein Sur7(Sur7) Protein, His-Tagged
Cat.No. : | RFL27216SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein SUR7(SUR7) Protein (P54003) (1-302aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-302) |
Form : | Lyophilized powder |
AA Sequence : | MVKVWNIVLRLVVLLFLAGNTLLLILMIISGATDHYPVNRFYWVQGNTTGIPNAGDETRW TFWGACLQDKDGSDTCTSNLAPAYPISPVDNFNTHINVPHQFISKRDAFYYLTRFSFCFF WIALAFVGVSFILYVLTWCSKMLSEMVLILMSFGFVFNTAAVVLQTAASAMAKNAFHDDH RSAQLGASMMGMAWASVFLCIVEFILLVFWSVRARLASTYSIDNSRYRTSSRWNPFHREK EQATDPILTATGPEDMQQSASIVGPSSNANPVTATAATENQPKGINFFTIRKSHERPDDV SV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SUR7 |
Synonyms | SUR7; YML052W; YM9958.11; Protein SUR7 |
UniProt ID | P54003 |
◆ Native Proteins | ||
ALB-116R | Native Rabbit Serum Albumin | +Inquiry |
Factor D-61H | Native Human Factor D | +Inquiry |
FSME-08 | Native FSME (TBE) Virus Antigen (Premium) | +Inquiry |
APOC1-616H | Native Human Apolipoprotein C-I | +Inquiry |
L. pneumophila-26 | Native Legionella pneumophila Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Breast-60H | Human Breast Tumor Lysate | +Inquiry |
PDPN-470MCL | Recombinant Mouse PDPN cell lysate | +Inquiry |
RGS6-2370HCL | Recombinant Human RGS6 293 Cell Lysate | +Inquiry |
RPL7L1-2188HCL | Recombinant Human RPL7L1 293 Cell Lysate | +Inquiry |
CHAC2-344HCL | Recombinant Human CHAC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SUR7 Products
Required fields are marked with *
My Review for All SUR7 Products
Required fields are marked with *
0
Inquiry Basket