Recombinant Full Length Saccharomyces Cerevisiae Protein Mrg3-Like (Ykl133C) Protein, His-Tagged
Cat.No. : | RFL12229SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein MRG3-like (YKL133C) Protein (P36066) (1-463aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-463) |
Form : | Lyophilized powder |
AA Sequence : | MWKYLHRSVKNEGTVERLTNLNLFTNHRFKFYSTLKEQSFWRIPFKRRSKLQKWVLSTGI VSFIAFNIWWVYWPHHTFPKPVAKILRKGLHSEIKKEGANYQKSLEYYLEALEECKAENV DLLSDEYTGIEIKIGEMYEKLHMYNDATALYGDMLKKFYNELSKTTDKSTKRKFFLLKRD LQILVRFNEINKDSETNATLLIMHLLLAQREFLENSPEFKNVLSKSELLNNQQLDWKNFK GLPFIGKSKPDYQMHLNSKRKQELKIKEPESEQCVFMKELLTARDLYTRYCLNRSNLSGA LNSKITTLEWMLLADSPLDDILLAQAELGSIFYLNSEKFEGSLYAIDNEPYKKSEPLELI RSRLQENQNSCLQYSADCYKSIISFANENQYPKVAMESEMDQRILKALSLAHYGIGVINL HKGRLRASKKELKKAIRISEMIRFNELIEEAQRELKKVDGTPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YKL133C |
Synonyms | YKL133C; Protein MRG3-like |
UniProt ID | P36066 |
◆ Native Proteins | ||
LDHA-8315C | Native Chicken LDHA | +Inquiry |
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
SERPINC1 -50P | Native Porcine Antithrombin III | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNDC12-626HCL | Recombinant Human TXNDC12 293 Cell Lysate | +Inquiry |
CAMTA2-7870HCL | Recombinant Human CAMTA2 293 Cell Lysate | +Inquiry |
NEIL1-3882HCL | Recombinant Human NEIL1 293 Cell Lysate | +Inquiry |
FAM71B-585HCL | Recombinant Human FAM71B cell lysate | +Inquiry |
XCL1-001CCL | Recombinant Canine XCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YKL133C Products
Required fields are marked with *
My Review for All YKL133C Products
Required fields are marked with *
0
Inquiry Basket