Recombinant Full Length Saccharomyces Cerevisiae Protein Hph1(Frt1) Protein, His-Tagged
Cat.No. : | RFL21314SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein HPH1(FRT1) Protein (Q99332) (1-602aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-602) |
Form : | Lyophilized powder |
AA Sequence : | MNLLIDRMENPGSRNCTLLPPSFPRGFCKGRRASSGDAVKIKESGLQPQPQPEPLQAKTN VAHFSKSSSRLPVIAVNDNPVVPRPSTEVNLGSLLQKEREKEKEEQPALHDRRHLYVTKN RAHGVRQRSLEMTSLPVLGSTKTGKFSDFLFEDDIDNRVGRHSRSYSGASSLDDPFRVSP KTDFNSNRARLSCLSKGRRGSMSVFQSCHTGLAFNQIQGSSSSQRRSSAGSFDYERKRLV NQFLQPSLGNSDPFDTLRESVVFEPSSTAGGIKLGNMHSQSQISVNSSPSTSLFYHDLDG SAVNDSSSFLYSRSNVPAFLSSSAFSSTSSTSSDSEDVDRRSLNGVYPSLGYLTNQRKPR NSSGSSTAPGTDTLGFKYLLNRQKSADSSTRFKSVLKVNNNNGSAATPDSSSNSISKSNS NLNDNIDELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDLLSGELTLLL DEMTTLRTTVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLN KQKSSLREMDSLIELKNVLNKSKNNTKSIYLYRYFIIDIIAFLLMGGFIVYVKNLLTRFF TR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FRT1 |
Synonyms | FRT1; HPH1; YOR324C; O6159; Protein HPH1; Functionally related to TCP1 protein 1; High pH protein 1 |
UniProt ID | Q99332 |
◆ Recombinant Proteins | ||
MOAP1-5452H | Recombinant Human MOAP1 Protein, GST-tagged | +Inquiry |
SiOle3,3-04 | Recombinant SiOle3,3 protein, N-10×His tagged | +Inquiry |
RFL33378RF | Recombinant Full Length Rhizobium Etli Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
BCAN-0075H | Recombinant Human BCAN Protein (Asp23-Pro911), C-His-tagged | +Inquiry |
Rundc1-5650M | Recombinant Mouse Rundc1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
FLNA-170C | Active Native chicken FLNA | +Inquiry |
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
GPT-65H | Active Native Human Glutamate Pyruvate Transaminase (GPT) | +Inquiry |
Lectin-1780G | Active Native Griffonia Simplicifolia Lectin I Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD47-1363RCL | Recombinant Rat CD47 cell lysate | +Inquiry |
MVP-4050HCL | Recombinant Human MVP 293 Cell Lysate | +Inquiry |
GTPBP5-5683HCL | Recombinant Human GTPBP5 293 Cell Lysate | +Inquiry |
VWC2-2150HCL | Recombinant Human VWC2 cell lysate | +Inquiry |
MOSPD1-4244HCL | Recombinant Human MOSPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FRT1 Products
Required fields are marked with *
My Review for All FRT1 Products
Required fields are marked with *
0
Inquiry Basket