Recombinant Full Length Saccharomyces Cerevisiae Protein Ccc1(Ccc1) Protein, His-Tagged
Cat.No. : | RFL5185SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein CCC1(CCC1) Protein (P47818) (1-322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-322) |
Form : | Lyophilized powder |
AA Sequence : | MSIVALKNAVVTLIQKAKGSGGTSELGGSESTPLLRGSNSNSSRHDNLSSSSSDIIYGRN SAQDLENSPMSVGKDNRNGDNGSDNEKANLGFFQSVDPRVISDLIIGLSDGLTVPFALTA GLSSLGDAKLVITGGFAELISGAISMGLGGYLGAKSESDYYHAEVKKEKRKFYDNSNLIN REIEDILLEINPNFSDETIVSFIKDLQRTPELMVDFIIRYGRGLDEPAENRELISAVTIG GGYLLGGLVPLVPYFFVSDVGTGLIYSIIVMVVTLFWFGYVKTKLSMGSGSSTSKKVTEG VEMVVVGGVAAGAAWFFVKLLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CCC1 |
Synonyms | CCC1; YLR220W; L8083.6; Protein CCC1; Cross-complementer of CSG1 protein 1 |
UniProt ID | P47818 |
◆ Native Proteins | ||
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
Annexin-013 | Native Annexin Protein, Gold conjugated | +Inquiry |
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
TF-102H | Native Human Transferrin (HOLO) | +Inquiry |
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAP1B-2528HCL | Recombinant Human RAP1B 293 Cell Lysate | +Inquiry |
Intestine-752B | Bovine Intestine Membrane Lysate, Total Protein | +Inquiry |
SAP30BP-2068HCL | Recombinant Human SAP30BP 293 Cell Lysate | +Inquiry |
RASD1-528HCL | Recombinant Human RASD1 lysate | +Inquiry |
ARHGDIA-8736HCL | Recombinant Human ARHGDIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCC1 Products
Required fields are marked with *
My Review for All CCC1 Products
Required fields are marked with *
0
Inquiry Basket