Recombinant Full Length Saccharomyces Cerevisiae Pheromone-Regulated Membrane Protein 5(Prm5) Protein, His-Tagged
Cat.No. : | RFL20214SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Pheromone-regulated membrane protein 5(PRM5) Protein (E7KPQ3) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MTVITIAKRGLPKLTTSTSSTTTASSSSTITSVXSSSSSLPLLSNSTSSSIIPSITPPSR NGNPYILDSGDMPNGTVFIVVGGIAGVIFLAILLWWVITTYSSHRLTRSVQDYESKMFSX QHTQFYGDSPYMDYPAKENFQDQVHISESDISPGNKDESVKDALVSHTNNEKPFLSNFER PLSSLVSESNRNSLFISPTGDILYKTRLSKLYQESPRLLQKPVIMTSDNVSTNSLVSTIS SSSASSLDNGNEKEVGEDIRKPAKIASSPSRKLLNSPESDGSVNRNHSKGNLLVVQSKRK PTPSTYLEHMLEGKEQDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PRM5 |
Synonyms | PRM5; QA23_2310; Pheromone-regulated membrane protein 5 |
UniProt ID | E7KPQ3 |
◆ Recombinant Proteins | ||
LEP-3523H | Recombinant Human LEP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RNF7-7690M | Recombinant Mouse RNF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fbln5-7899M | Recombinant Mouse Fbln5 protein, His-tagged | +Inquiry |
TMPRSS2-8077H | Recombinant Human TMPRSS2 protein, His-tagged | +Inquiry |
NFE2L2-1917H | Recombinant Human NFE2L2 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
PT-141B | Native Bordetella pertussis Perrtussis toxin | +Inquiry |
Y. enterocolitica-31 | Native Yersinia enterocolitica O:9 Antigen | +Inquiry |
Immunoglobulin G-038S | Native Sheep Immunoglobulin G Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEP57L1-124HCL | Recombinant Human CEP57L1 lysate | +Inquiry |
NRG1-1675HCL | Recombinant Human NRG1 cell lysate | +Inquiry |
CDH15-1484RCL | Recombinant Rat CDH15 cell lysate | +Inquiry |
IL17RB-1115MCL | Recombinant Mouse IL17RB cell lysate | +Inquiry |
H2AFJ-5662HCL | Recombinant Human H2AFJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRM5 Products
Required fields are marked with *
My Review for All PRM5 Products
Required fields are marked with *
0
Inquiry Basket