Recombinant Full Length Saccharomyces Cerevisiae Pheromone-Regulated Membrane Protein 5(Prm5) Protein, His-Tagged
Cat.No. : | RFL13973SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Pheromone-regulated membrane protein 5(PRM5) Protein (A6ZVG0) (1-321aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-321) |
Form : | Lyophilized powder |
AA Sequence : | MTVITIAKRGLPKLTTSTSSTTTASSSSTITSVVSSSSSSSSLPLLSNSTSSSIIPSITP PSRNGNPYILDSGDMPNGTVFIIVGGIAGVIFLAILLWWVITTYSSHRLTRSVQDYESKM FSAQHTQFYGDSPYMDYPAKENFQDQVHISESDISPGNKDESVKDALVSHTNNEKPFLSN FERPLSSLVSESNRNSLFISPTGDILNKTRLSKLYQESPRLLQKPVIMTSDNVSTNSLVS TISSSSASSLDNGNEKEVGEDIRKPAKIASSPSRKLLNSPESDGSVNRNHSKGNLLVVQS KRKPTPSTYLEHMLEGKEQDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PRM5 |
Synonyms | PRM5; SCY_2676; Pheromone-regulated membrane protein 5 |
UniProt ID | A6ZVG0 |
◆ Recombinant Proteins | ||
CD300A-1694R | Recombinant Rhesus Monkey CD300A Protein, hIgG4-tagged | +Inquiry |
PFKFB2-4391R | Recombinant Rat PFKFB2 Protein | +Inquiry |
BCKDK-437H | Recombinant Human BCKDK Protein, His (Fc)-Avi-tagged | +Inquiry |
UBXN4-12278Z | Recombinant Zebrafish UBXN4 | +Inquiry |
TCERG1-3155H | Recombinant Human TCERG1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
CTSG-1649H | Active Native Human CTSG protein | +Inquiry |
GAPDH-62H | Native Human Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIN7A-4730HCL | Recombinant Human LIN7A 293 Cell Lysate | +Inquiry |
STBD1-694HCL | Recombinant Human STBD1 cell lysate | +Inquiry |
GLRX5-5896HCL | Recombinant Human GLRX5 293 Cell Lysate | +Inquiry |
TPM4-1036HCL | Recombinant Human TPM4 cell lysate | +Inquiry |
NUB1-3663HCL | Recombinant Human NUB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRM5 Products
Required fields are marked with *
My Review for All PRM5 Products
Required fields are marked with *
0
Inquiry Basket