Recombinant Full Length Saccharomyces Cerevisiae Ph-Response Regulator Protein Palh/Rim21(Rim21) Protein, His-Tagged
Cat.No. : | RFL23363SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae pH-response regulator protein palH/RIM21(RIM21) Protein (P48565) (1-533aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-533) |
Form : | Lyophilized powder |
AA Sequence : | MNLWRHSPEELAAYNSCHPMKLGSGVLIQLPLYDNSAVYAEDITFRSFCCERVPVYVSTV LRNSSPYRYLDEVINDWQKFIQVSDYVGGSAEYAIYAVILSITSNFVITVFLTVICCINI SGRAYKRILQLLRIASLLASLNLTIFITKVLRRLEKEHNVYGVVRAHSIMHIFSDDMTFV VLDFLATLMFQFCQVGIVIRLFQRAQEKRIIFFIGVILTITANILWVIPPFANHTTKHRN DWQILRPFVYLFRIAIATSYASIVIYHIWQKKKLWFKFNQMGLLTLLTILVVLLLPGFFL ADVSNLWISELGEVFNTTCYVTSTVITWEWLDRLNVLERKEEAQSILGRPIFEEEQQDYR FAKYALRVQNALTRRESQDASTDRHDTSSNSEVCDLQTISRYDPEDQISVGRSIDRMHFN DRGTYKDVALKKLGYARDKILYFTDQIVQKSVGHNNSSSSKNEKTKQRKAMVRKRLGLDK PGIYIYSTKDVVFNSDEDDDENAEDEDDDEYEVGSEGNNNSSATFTSDHIGHI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIM21 |
Synonyms | RIM21; PAL2; YNL294C; N0466; pH-response regulator protein palH/RIM21; Regulator of IME2 protein 21 |
UniProt ID | P48565 |
◆ Recombinant Proteins | ||
NDP-5352C | Recombinant Chicken NDP | +Inquiry |
FABP4-831M | Recombinant Mouse FABP4 Protein (Cys2-Ala132), His-MYC-tagged | +Inquiry |
SERPINF2-16H | Recombinant Human SERPINF2 protein, MYC/DDK-tagged | +Inquiry |
HLA-DMB-6533H | Recombinant Human HLA-DMB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CRYGA-1042R | Recombinant Rhesus monkey CRYGA Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Hemoglobin Glutamer-01B | Native Bovine Hemoglobin Glutamer | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
LTF-175H | Native Human lactoferrin | +Inquiry |
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGSF6-5255HCL | Recombinant Human IGSF6 293 Cell Lysate | +Inquiry |
TFDP1-1132HCL | Recombinant Human TFDP1 293 Cell Lysate | +Inquiry |
DALRD3-7081HCL | Recombinant Human DALRD3 293 Cell Lysate | +Inquiry |
LAPTM4A-4823HCL | Recombinant Human LAPTM4A 293 Cell Lysate | +Inquiry |
UHRF1BP1L-908HCL | Recombinant Human UHRF1BP1L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RIM21 Products
Required fields are marked with *
My Review for All RIM21 Products
Required fields are marked with *
0
Inquiry Basket